CF832434

Overview
NameCF832434
Unique NameCF832434
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length557
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1033 contig Csv1_Contig1033:43..598. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832434 vs. ExPASy Swiss-Prot
Match: TOP6B_ARATH (DNA topoisomerase 6 subunit B OS=Arabidopsis thaliana GN=TOP6B PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 1.053e-80
Identity = 97/114 (85.09%), Postives = 105/114 (92.11%), Query Frame = 1
Query:  214 KALITETSKGTLLQFLQHKFVNIGKSLAERLIGEMGPEFNPKMAVKSLTSQQIVRIHQLFRQAKFDDPSGGCLNPAGEYNLRLCIIKELHPYMVATYSGSAQVFEGHPFIVEAG 555
            K LIT+TSK TLLQFLQ++FVNI K+LA RLIGEMGP+F P MAVKS+TSQQ+VRIHQLFRQAKFDDPSG CL+PAGEYNLRL IIKELHP MVATYSGSAQVFEGHPFIVEAG
Sbjct:  331 KRLITDTSKKTLLQFLQNEFVNINKTLAARLIGEMGPDFGPSMAVKSVTSQQMVRIHQLFRQAKFDDPSGDCLSPAGEYNLRLGIIKELHPDMVATYSGSAQVFEGHPFIVEAG 444          

HSP 2 Score: 127.487 bits (319), Expect = 1.053e-80
Identity = 59/69 (85.51%), Postives = 65/69 (94.20%), Query Frame = 3
Query:    9 NWTTYRSKILHYLRQMAVITPYAQFLFKFESEVAEKNVTIRFSRRTDVMPPGPVDTKHHPSSVDLLLIK 215
            NWTTYRSKILHY+RQMAVITPYAQFLF+F SE  EKNVTI+F+RRTDVMPP P++TKHHPSSVDLLLIK
Sbjct:  263 NWTTYRSKILHYMRQMAVITPYAQFLFRFISETPEKNVTIKFTRRTDVMPPIPIETKHHPSSVDLLLIK 331          
BLAST of CF832434 vs. ExPASy Swiss-Prot
Match: TOP6B_SULSO (Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus solfataricus GN=top6B PE=3 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.679e-18
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  244 TLLQFLQHKFVNIGKSLAERLIGEMGPEFNPKMAVKSLTSQQIVRIHQLFRQAK-FDDPSGGCLNPAGEYNLRLCIIKELHPYMVATYSGSAQVFEGHPFIVEAG 555
            T+ +FL  +F +IG + A++++  +G    P   VK+LT ++I R+ + F++ + F  PS   L+  GE  + L + K  +P   A+ +   + ++GHPFIVEAG
Sbjct:  253 TIKEFLMSEFQSIGDTTADKILELVG--LRPNKKVKNLTEEEITRLVETFKKYEDFRSPSADSLSVIGEDLIELGLKKIFNPDFTASITRKPKAYQGHPFIVEAG 355          

HSP 2 Score: 50.8322 bits (120), Expect = 1.679e-18
Identity = 31/79 (39.24%), Postives = 44/79 (55.70%), Query Frame = 3
Query:    9 NWTTYRSKILHYLRQMAVITPYAQFLFKFESEVAEKNVTIRFSRRTDVMPPGPVDTKHHPSSVDLLLIKGTYYRNFKRD 245
            +W   +S+I  Y+++  +ITPYA+F+FK      E NVT  + R T+ +P  P + K HP  VD   IK     N KRD
Sbjct:  179 DWPKAKSRIYEYIKRTYIITPYAEFIFK----DPEGNVTY-YPRLTNKIPKPPQEVKPHPYGVDREEIK-IMINNLKRD 251          
BLAST of CF832434 vs. ExPASy Swiss-Prot
Match: TOP6B_SULSH (Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus shibatae GN=top6B PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.839e-18
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  244 TLLQFLQHKFVNIGKSLAERLIGEMGPEFNPKMAVKSLTSQQIVRIHQLFRQAK-FDDPSGGCLNPAGEYNLRLCIIKELHPYMVATYSGSAQVFEGHPFIVEAG 555
            T+ +FL ++F +IG + A++++   G    P   VK+LT ++I R+ + F++ + F  PS   L+  GE  + L + K  +P   A+ +   + ++GHPFIVEAG
Sbjct:  253 TIKEFLVNEFQSIGDTTADKILELAG--LKPNKKVKNLTEEEITRLVETFKKDEDFRSPSADSLSVIGEDLIELGLKKIFNPDFAASITRKPKAYQGHPFIVEAG 355          

HSP 2 Score: 50.8322 bits (120), Expect = 2.839e-18
Identity = 31/79 (39.24%), Postives = 44/79 (55.70%), Query Frame = 3
Query:    9 NWTTYRSKILHYLRQMAVITPYAQFLFKFESEVAEKNVTIRFSRRTDVMPPGPVDTKHHPSSVDLLLIKGTYYRNFKRD 245
            +W   +S+I  Y+++  +ITPYA+F+FK      E NVT  + R T+ +P  P + K HP  VD   IK     N KRD
Sbjct:  179 DWPKAKSRIYEYIKRTYIITPYAEFIFK----DPEGNVTY-YPRLTNKIPKPPQEVKPHPYGVDREEIK-ILINNLKRD 251          
BLAST of CF832434 vs. ExPASy Swiss-Prot
Match: TOP6B_SULIY (Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=top6B PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.839e-18
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  244 TLLQFLQHKFVNIGKSLAERLIGEMGPEFNPKMAVKSLTSQQIVRIHQLFRQAK-FDDPSGGCLNPAGEYNLRLCIIKELHPYMVATYSGSAQVFEGHPFIVEAG 555
            T+ +FL ++F +IG + A++++   G    P   VK+LT ++I R+ + F++ + F  PS   L+  GE  + L + K  +P   A+ +   + ++GHPFIVEAG
Sbjct:  253 TIKEFLVNEFQSIGDTTADKILELAG--LKPNKKVKNLTEEEITRLVETFKKYEDFRSPSADSLSVIGEDLIELGLKKIFNPDFAASITRKPKAYQGHPFIVEAG 355          

HSP 2 Score: 50.8322 bits (120), Expect = 2.839e-18
Identity = 31/79 (39.24%), Postives = 44/79 (55.70%), Query Frame = 3
Query:    9 NWTTYRSKILHYLRQMAVITPYAQFLFKFESEVAEKNVTIRFSRRTDVMPPGPVDTKHHPSSVDLLLIKGTYYRNFKRD 245
            +W   +S+I  Y+++  +ITPYA+F+FK      E NVT  + R T+ +P  P + K HP  VD   IK     N KRD
Sbjct:  179 DWPKAKSRIYEYIKRTYIITPYAEFIFK----DPEGNVTY-YPRLTNKIPKPPQEVKPHPYGVDREEIK-ILINNLKRD 251          
BLAST of CF832434 vs. ExPASy Swiss-Prot
Match: TOP6B_SULIN (Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=top6B PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.839e-18
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  244 TLLQFLQHKFVNIGKSLAERLIGEMGPEFNPKMAVKSLTSQQIVRIHQLFRQAK-FDDPSGGCLNPAGEYNLRLCIIKELHPYMVATYSGSAQVFEGHPFIVEAG 555
            T+ +FL ++F +IG + A++++   G    P   VK+LT ++I R+ + F++ + F  PS   L+  GE  + L + K  +P   A+ +   + ++GHPFIVEAG
Sbjct:  253 TIKEFLVNEFQSIGDTTADKILELAG--LKPNKKVKNLTEEEITRLVETFKKYEDFRSPSADSLSVIGEDLIELGLKKIFNPDFAASITRKPKAYQGHPFIVEAG 355          

HSP 2 Score: 50.8322 bits (120), Expect = 2.839e-18
Identity = 31/79 (39.24%), Postives = 44/79 (55.70%), Query Frame = 3
Query:    9 NWTTYRSKILHYLRQMAVITPYAQFLFKFESEVAEKNVTIRFSRRTDVMPPGPVDTKHHPSSVDLLLIKGTYYRNFKRD 245
            +W   +S+I  Y+++  +ITPYA+F+FK      E NVT  + R T+ +P  P + K HP  VD   IK     N KRD
Sbjct:  179 DWPKAKSRIYEYIKRTYIITPYAEFIFK----DPEGNVTY-YPRLTNKIPKPPQEVKPHPYGVDREEIK-ILINNLKRD 251          
BLAST of CF832434 vs. ExPASy Swiss-Prot
Match: TOP6B_SULIM (Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=top6B PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.839e-18
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  244 TLLQFLQHKFVNIGKSLAERLIGEMGPEFNPKMAVKSLTSQQIVRIHQLFRQAK-FDDPSGGCLNPAGEYNLRLCIIKELHPYMVATYSGSAQVFEGHPFIVEAG 555
            T+ +FL ++F +IG + A++++   G    P   VK+LT ++I R+ + F++ + F  PS   L+  GE  + L + K  +P   A+ +   + ++GHPFIVEAG
Sbjct:  253 TIKEFLVNEFQSIGDTTADKILELAG--LKPNKKVKNLTEEEITRLVETFKKYEDFRSPSADSLSVIGEDLIELGLKKIFNPDFAASITRKPKAYQGHPFIVEAG 355          

HSP 2 Score: 50.8322 bits (120), Expect = 2.839e-18
Identity = 31/79 (39.24%), Postives = 44/79 (55.70%), Query Frame = 3
Query:    9 NWTTYRSKILHYLRQMAVITPYAQFLFKFESEVAEKNVTIRFSRRTDVMPPGPVDTKHHPSSVDLLLIKGTYYRNFKRD 245
            +W   +S+I  Y+++  +ITPYA+F+FK      E NVT  + R T+ +P  P + K HP  VD   IK     N KRD
Sbjct:  179 DWPKAKSRIYEYIKRTYIITPYAEFIFK----DPEGNVTY-YPRLTNKIPKPPQEVKPHPYGVDREEIK-ILINNLKRD 251          
BLAST of CF832434 vs. ExPASy Swiss-Prot
Match: TOP6B_SULIL (Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=top6B PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.839e-18
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  244 TLLQFLQHKFVNIGKSLAERLIGEMGPEFNPKMAVKSLTSQQIVRIHQLFRQAK-FDDPSGGCLNPAGEYNLRLCIIKELHPYMVATYSGSAQVFEGHPFIVEAG 555
            T+ +FL ++F +IG + A++++   G    P   VK+LT ++I R+ + F++ + F  PS   L+  GE  + L + K  +P   A+ +   + ++GHPFIVEAG
Sbjct:  253 TIKEFLVNEFQSIGDTTADKILELAG--LKPNKKVKNLTEEEITRLVETFKKYEDFRSPSADSLSVIGEDLIELGLKKIFNPDFAASITRKPKAYQGHPFIVEAG 355          

HSP 2 Score: 50.8322 bits (120), Expect = 2.839e-18
Identity = 31/79 (39.24%), Postives = 44/79 (55.70%), Query Frame = 3
Query:    9 NWTTYRSKILHYLRQMAVITPYAQFLFKFESEVAEKNVTIRFSRRTDVMPPGPVDTKHHPSSVDLLLIKGTYYRNFKRD 245
            +W   +S+I  Y+++  +ITPYA+F+FK      E NVT  + R T+ +P  P + K HP  VD   IK     N KRD
Sbjct:  179 DWPKAKSRIYEYIKRTYIITPYAEFIFK----DPEGNVTY-YPRLTNKIPKPPQEVKPHPYGVDREEIK-ILINNLKRD 251          
BLAST of CF832434 vs. ExPASy Swiss-Prot
Match: TOP6B_SULIK (Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=top6B PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.839e-18
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  244 TLLQFLQHKFVNIGKSLAERLIGEMGPEFNPKMAVKSLTSQQIVRIHQLFRQAK-FDDPSGGCLNPAGEYNLRLCIIKELHPYMVATYSGSAQVFEGHPFIVEAG 555
            T+ +FL ++F +IG + A++++   G    P   VK+LT ++I R+ + F++ + F  PS   L+  GE  + L + K  +P   A+ +   + ++GHPFIVEAG
Sbjct:  253 TIKEFLVNEFQSIGDTTADKILELAG--LKPNKKVKNLTEEEITRLVETFKKYEDFRSPSADSLSVIGEDLIELGLKKIFNPDFAASITRKPKAYQGHPFIVEAG 355          

HSP 2 Score: 50.8322 bits (120), Expect = 2.839e-18
Identity = 31/79 (39.24%), Postives = 44/79 (55.70%), Query Frame = 3
Query:    9 NWTTYRSKILHYLRQMAVITPYAQFLFKFESEVAEKNVTIRFSRRTDVMPPGPVDTKHHPSSVDLLLIKGTYYRNFKRD 245
            +W   +S+I  Y+++  +ITPYA+F+FK      E NVT  + R T+ +P  P + K HP  VD   IK     N KRD
Sbjct:  179 DWPKAKSRIYEYIKRTYIITPYAEFIFK----DPEGNVTY-YPRLTNKIPKPPQEVKPHPYGVDREEIK-ILINNLKRD 251          
BLAST of CF832434 vs. ExPASy Swiss-Prot
Match: TOP6B_SULIA (Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus islandicus (strain M.16.27) GN=top6B PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.839e-18
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  244 TLLQFLQHKFVNIGKSLAERLIGEMGPEFNPKMAVKSLTSQQIVRIHQLFRQAK-FDDPSGGCLNPAGEYNLRLCIIKELHPYMVATYSGSAQVFEGHPFIVEAG 555
            T+ +FL ++F +IG + A++++   G    P   VK+LT ++I R+ + F++ + F  PS   L+  GE  + L + K  +P   A+ +   + ++GHPFIVEAG
Sbjct:  253 TIKEFLVNEFQSIGDTTADKILELAG--LKPNKKVKNLTEEEITRLVETFKKYEDFRSPSADSLSVIGEDLIELGLKKIFNPDFAASITRKPKAYQGHPFIVEAG 355          

HSP 2 Score: 50.8322 bits (120), Expect = 2.839e-18
Identity = 31/79 (39.24%), Postives = 44/79 (55.70%), Query Frame = 3
Query:    9 NWTTYRSKILHYLRQMAVITPYAQFLFKFESEVAEKNVTIRFSRRTDVMPPGPVDTKHHPSSVDLLLIKGTYYRNFKRD 245
            +W   +S+I  Y+++  +ITPYA+F+FK      E NVT  + R T+ +P  P + K HP  VD   IK     N KRD
Sbjct:  179 DWPKAKSRIYEYIKRTYIITPYAEFIFK----DPEGNVTY-YPRLTNKIPKPPQEVKPHPYGVDREEIK-ILINNLKRD 251          
BLAST of CF832434 vs. ExPASy Swiss-Prot
Match: TOP6B_AERPE (Type 2 DNA topoisomerase 6 subunit B OS=Aeropyrum pernix GN=top6B PE=3 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 7.394e-15
Identity = 32/116 (27.59%), Postives = 56/116 (48.28%), Query Frame = 1
Query:  214 KALITETSKGTLLQFLQHKFVNIGKSLAERLIGEMG--PEFNPKMAVKSLTSQQIVRIHQLFRQAKFDDPSGGCLNPAGEYNLRLCIIKELHPYMVATYSGSAQVFEGHPFIVEAG 555
            K+++  T   TL +FL  +F +IG   A+  + + G  P+  P+  +K    + + R+     +  F  P    L+P G   + + + +  +P  V   S S + + GHPFIVE G
Sbjct:  268 KSMLRSTRASTLREFLVKEFQSIGDKTAQDFLEKYGLDPDLKPRELLKKGRDKLLRRLADALMEYPFRAPKSDYLSPIGSDIIEIGLRRMFNPEWVGAVSRSPKAYRGHPFIVEVG 383          

HSP 2 Score: 45.0542 bits (105), Expect = 7.394e-15
Identity = 23/69 (33.33%), Postives = 37/69 (53.62%), Query Frame = 3
Query:    9 NWTTYRSKILHYLRQMAVITPYAQFLFKFESEVAEKNVTIRFSRRTDVMPPGPVDTKHHPSSVDLLLIK 215
            +W+  +SKIL Y+++ AVI PYA+ + +             F R T  +P  P ++K HP  VD+  +K
Sbjct:  205 DWSRAKSKILEYIKRTAVIAPYAEIILE-----TPDGEIYYFPRSTRKLPKPPRESKPHPHGVDIEQLK 268          
The following BLAST results are available for this feature:
BLAST of CF832434 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
TOP6B_ARATH1.053e-8085.09DNA topoisomerase 6 subunit B OS=Arabidopsis thali... [more]
TOP6B_SULSO1.679e-1833.33Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus... [more]
TOP6B_SULSH2.839e-1833.33Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus... [more]
TOP6B_SULIY2.839e-1833.33Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus... [more]
TOP6B_SULIN2.839e-1833.33Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus... [more]
TOP6B_SULIM2.839e-1833.33Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus... [more]
TOP6B_SULIL2.839e-1833.33Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus... [more]
TOP6B_SULIK2.839e-1833.33Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus... [more]
TOP6B_SULIA2.839e-1833.33Type 2 DNA topoisomerase 6 subunit B OS=Sulfolobus... [more]
TOP6B_AERPE7.394e-1527.59Type 2 DNA topoisomerase 6 subunit B OS=Aeropyrum ... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS02_01N18_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01N18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832434 ID=CF832434|Name=CF832434|organism=Citrus sinensis|type=EST|length=557bp
TCCATTGAAATTGGACAACTTACCGTTCTAAGATATTGCATTACCTGCGA
CAAATGGCTGTTATCACTCCTTATGCCCAATTTCTATTTAAATTTGAATC
TGAAGTGGCCGAAAAAAACGTCACTATTAGATTTTCACGGAGAACAGACG
TAATGCCTCCAGGTCCTGTTGACACAAAGCACCACCCCTCTTCTGTAGAT
TTACTTTTAATCAAAGGCACTTATTACAGAAACTTCAAAAGGGACTCTCT
TGCAGTTTCTGCAGCATAAATTTGTAAATATAGGAAAGTCCCTTGCTGAA
CGGTTAATTGGTGAAATGGGTCCTGAATTTAACCCAAAAATGGCTGTCAA
GTCTTTAACTTCTCAGCAAATAGTGCGTATCCATCAGTTGTTTCGTCAAG
CTAAATTTGATGACCCTAGTGGTGGTTGTCTTAATCCTGCAGGGGAATAC
AATCTTCGACTATGTATTATAAAGGAACTTCATCCATACATGGTAGCAAC
CTATTCAGGCAGTGCTCAAGTTTTCGAGGGGCATCCATTCATTGTGGAAG
CTGGTGT
back to top