CF832446

Overview
NameCF832446
Unique NameCF832446
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length599
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2181 contig Csv1_Contig2181:36..634. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832446 vs. ExPASy Swiss-Prot
Match: CP20A_ARATH (Peptidyl-prolyl cis-trans isomerase CYP20-1 OS=Arabidopsis thaliana GN=CYP20-1 PE=1 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 3.594e-75
Identity = 140/177 (79.10%), Postives = 150/177 (84.75%), Query Frame = 2
Query:   68 MLWAVILLATFSIILAKKSDQNLKEITNKVDFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSVMDVVYKVEAEG 598
            +LW+++LL T S I AKKS +NLKEIT+KV FDVEI GK AGRIVMGLFGK VPKT ENFRALCTGEKGIGK+GK LHYKGS+FHRIIPSFMLQ            ESIYGEKF DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWLDGRHVVFGKV++ MDVVYKVEAEG
Sbjct:    8 LLWSLLLLGTLSAIQAKKSKENLKEITHKVYFDVEIDGKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKNGKALHYKGSSFHRIIPSFMLQGGDFTHGNGMGGESIYGEKFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWLDGRHVVFGKVVTGMDVVYKVEAEG 184          
BLAST of CF832446 vs. ExPASy Swiss-Prot
Match: CP19D_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-4 OS=Arabidopsis thaliana GN=CYP19-4 PE=1 SV=2)

HSP 1 Score: 261.536 bits (667), Expect = 2.257e-69
Identity = 130/175 (74.29%), Postives = 146/175 (83.43%), Query Frame = 2
Query:   83 ILLAT---FSIILAKKSDQNLKEITNKVDFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSVMDVVYKVEAEG 598
            ILL T   F  I + ++ ++LKE+T+KV FDVEI GK AGR+V+GLFGKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFM+Q            ESIYG+KF DENFKLKHTGPG+LSMAN+G DTNGSQFFITTVTTSWLDGRHVVFGKV+  MDVVYK+EAEG
Sbjct:    7 ILLGTLFLFGAIASIQAKEDLKEVTHKVYFDVEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSMANSGEDTNGSQFFITTVTTSWLDGRHVVFGKVVQGMDVVYKIEAEG 181          
BLAST of CF832446 vs. ExPASy Swiss-Prot
Match: PPIB_DICDI (Peptidyl-prolyl cis-trans isomerase B OS=Dictyostelium discoideum GN=cypB PE=1 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 3.057e-58
Identity = 108/153 (70.59%), Postives = 123/153 (80.39%), Query Frame = 2
Query:  140 EITNKVDFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSVMDVVYKVEAEG 598
            +ITNKV FD+EI  KPAGRIV GL+GK VPKT ENFRALCTGEKG+G SGKPLHYK S FHRIIP+FM+Q            ESIYG+KF DENFK+KH+ PGLLSMANAGP+TNGSQFFITTV TSWLDGRH VFG+V+  MD+V  +E+ G
Sbjct:   27 KITNKVFFDIEIDNKPAGRIVFGLYGKTVPKTVENFRALCTGEKGLGTSGKPLHYKDSKFHRIIPNFMIQGGDFTRGDGTGGESIYGKKFNDENFKIKHSKPGLLSMANAGPNTNGSQFFITTVVTSWLDGRHTVFGEVIEGMDIVKLLESIG 179          
BLAST of CF832446 vs. ExPASy Swiss-Prot
Match: CYP7_CAEEL (Peptidyl-prolyl cis-trans isomerase 7 OS=Caenorhabditis elegans GN=cyn-7 PE=1 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 1.162e-57
Identity = 105/149 (70.47%), Postives = 120/149 (80.54%), Query Frame = 2
Query:  152 KVDFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSVMDVVYKVEAEG 598
            +V FD+ IAGKP GRIVM L+   VPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIP FM+Q            ESIYGEKFPDENFK KHTGPG+LSMANAGP+TNGSQFF+ TV T+WLDG+HVVFG+V+  +D+V KVE  G
Sbjct:    5 RVFFDITIAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLDGKHVVFGRVVEGLDIVSKVEGNG 153          
BLAST of CF832446 vs. ExPASy Swiss-Prot
Match: CYP3_CAEEL (Peptidyl-prolyl cis-trans isomerase 3 OS=Caenorhabditis elegans GN=cyn-3 PE=1 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 4.132e-55
Identity = 103/150 (68.67%), Postives = 118/150 (78.67%), Query Frame = 2
Query:  149 NKVDFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSVMDVVYKVEAEG 598
            +KV FD+ I GK +GRIVM L+   VPKTA NFRALCTGE GIGKSGKPLH+KGS FHRIIP+FM+Q            ESIYGEKFPDENFK KHTGPG+LSMANAGP+TNGSQFF+ TV T WLDG+HVVFG+V+  +DVV  VE+ G
Sbjct:    4 SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNG 153          
BLAST of CF832446 vs. ExPASy Swiss-Prot
Match: CYPH_SOLLC (Peptidyl-prolyl cis-trans isomerase OS=Solanum lycopersicum GN=CYP PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.329e-53
Identity = 101/149 (67.79%), Postives = 111/149 (74.50%), Query Frame = 2
Query:  152 KVDFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSVMDVVYKVEAEG 598
            KV FD+ I G PAGR+VM LF    PKTAENFRALCTGEKG+GK GKPLHYKGSTFHR+IP FM Q            ESIYG KF DENF  KHTGPG+LSMANAGP TNGSQFFI T  T WL+G+HVVFG+V+  MDV+ K EA G
Sbjct:    5 KVFFDLTIGGAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFNDENFVKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVG 153          
BLAST of CF832446 vs. ExPASy Swiss-Prot
Match: CYPH_MAIZE (Peptidyl-prolyl cis-trans isomerase OS=Zea mays GN=CYP PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 5.051e-53
Identity = 100/149 (67.11%), Postives = 112/149 (75.17%), Query Frame = 2
Query:  152 KVDFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSVMDVVYKVEAEG 598
            +V FD+ + G PAGRIVM L+   VPKTAENFRALCTGEKG+GKSGKPLHYKGSTFHR+IP FM Q            ESIYGEKFPDE F  K   PG+LSMANAGP+TNGSQFFI TV T WLDG+HVVFG+V+  MDVV  +E  G
Sbjct:    5 RVFFDMTVGGAPAGRIVMELYANEVPKTAENFRALCTGEKGVGKSGKPLHYKGSTFHRVIPEFMCQGGDFTRGNGTGGESIYGEKFPDEKFVRKQPAPGVLSMANAGPNTNGSQFFICTVATPWLDGKHVVFGQVVEGMDVVKAIEKVG 153          
BLAST of CF832446 vs. ExPASy Swiss-Prot
Match: CYP2_CAEEL (Peptidyl-prolyl cis-trans isomerase 2 OS=Caenorhabditis elegans GN=cyn-2 PE=2 SV=2)

HSP 1 Score: 205.297 bits (521), Expect = 1.919e-52
Identity = 100/149 (67.11%), Postives = 114/149 (76.51%), Query Frame = 2
Query:  152 KVDFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSVMDVVYKVEAEG 598
            KV FD+ I GK  GRIVM L+   VPKTAENFRALCTGEKG GKSGK LH+KGS FHRIIP FM+Q            ESI+GEKF DENFK KHTGPG+LSMAN G +TNGSQFF+ TV T+WLDG+HVVFGKV+  MDVV  +E++G
Sbjct:    5 KVFFDITIGGKKGGRIVMELYNDIVPKTAENFRALCTGEKGKGKSGKKLHFKGSKFHRIIPEFMIQGGDFTEGNGTGGESIHGEKFDDENFKEKHTGPGVLSMANCGANTNGSQFFLCTVKTTWLDGKHVVFGKVIEGMDVVKAIESKG 153          
BLAST of CF832446 vs. ExPASy Swiss-Prot
Match: CYPH_LUPLU (Peptidyl-prolyl cis-trans isomerase OS=Lupinus luteus PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 3.274e-52
Identity = 99/149 (66.44%), Postives = 112/149 (75.17%), Query Frame = 2
Query:  152 KVDFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSVMDVVYKVEAEG 598
            KV FD+ IAG PAGRIVM L+    P+TAENFRALCTGEKG+G+SGKPLHYKGSTFHR+IP+FM Q            ESIYG KF DENF  +HTGPG+LSMANAG  TNGSQFFI T  T WLDG+HVVFGKV+  M+VV  +E  G
Sbjct:    5 KVFFDMAIAGNPAGRIVMELYADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSTFHRVIPNFMCQGGDFTAGNGTGAESIYGAKFADENFIKRHTGPGILSMANAGAGTNGSQFFICTEKTEWLDGKHVVFGKVIEGMNVVRDIEKVG 153          
BLAST of CF832446 vs. ExPASy Swiss-Prot
Match: CYPH_CATRO (Peptidyl-prolyl cis-trans isomerase OS=Catharanthus roseus GN=PCKR1 PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 9.525e-52
Identity = 97/149 (65.10%), Postives = 111/149 (74.50%), Query Frame = 2
Query:  152 KVDFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSVMDVVYKVEAEG 598
            +V FD+ + G+PAGRIVM LF    P+TAENFRALCTGEKG G+SGKPLHYK S+FHR+IP FM Q            ESIYG KF DENF  KHTGPG+LSMANAGP+TNGSQFFI T  T WLDG+HVVFG+V+  MDVV  +E  G
Sbjct:    5 RVFFDMSVGGQPAGRIVMELFADTTPRTAENFRALCTGEKGTGRSGKPLHYKDSSFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVG 153          
The following BLAST results are available for this feature:
BLAST of CF832446 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 232
Match NameE-valueIdentityDescription
CP20A_ARATH3.594e-7579.10Peptidyl-prolyl cis-trans isomerase CYP20-1 OS=Ara... [more]
CP19D_ARATH2.257e-6974.29Peptidyl-prolyl cis-trans isomerase CYP19-4 OS=Ara... [more]
PPIB_DICDI3.057e-5870.59Peptidyl-prolyl cis-trans isomerase B OS=Dictyoste... [more]
CYP7_CAEEL1.162e-5770.47Peptidyl-prolyl cis-trans isomerase 7 OS=Caenorhab... [more]
CYP3_CAEEL4.132e-5568.67Peptidyl-prolyl cis-trans isomerase 3 OS=Caenorhab... [more]
CYPH_SOLLC1.329e-5367.79Peptidyl-prolyl cis-trans isomerase OS=Solanum lyc... [more]
CYPH_MAIZE5.051e-5367.11Peptidyl-prolyl cis-trans isomerase OS=Zea mays GN... [more]
CYP2_CAEEL1.919e-5267.11Peptidyl-prolyl cis-trans isomerase 2 OS=Caenorhab... [more]
CYPH_LUPLU3.274e-5266.44Peptidyl-prolyl cis-trans isomerase OS=Lupinus lut... [more]
CYPH_CATRO9.525e-5265.10Peptidyl-prolyl cis-trans isomerase OS=Catharanthu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01N24_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01N24, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832446 ID=CF832446|Name=CF832446|organism=Citrus sinensis|type=EST|length=599bp
GCCGGTGACTGCAGAATGAGAAACAACGAAGTGATATATGGCTTCAACAA
ATTTGCTTCCACTCACGATGCTATGGGCTGTTATCCTGTTGGCCACTTTC
TCTATAATTCTGGCGAAAAAATCGGATCAGAATTTGAAAGAAATCACAAA
CAAAGTTGACTTTGACGTTGAGATTGCCGGAAAACCTGCCGGACGTATTG
TAATGGGTCTCTTTGGAAAGGCAGTCCCTAAAACTGCAGAAAATTTCCGA
GCTTTGTGCACAGGGGAGAAAGGGATTGGCAAGAGTGGGAAGCCACTCCA
CTACAAGGGAAGTACGTTTCATAGGATTATTCCCAGCTTTATGCTTCAAG
GAGGTGATTTCACTCTTGGTGATGGAAGAGGTGGAGAGTCAATTTATGGA
GAGAAGTTCCCTGACGAAAATTTCAAACTGAAGCACACCGGCCCAGGGCT
TTTGTCAATGGCAAATGCTGGGCCAGACACCAATGGTTCACAATTCTTCA
TTACAACTGTGACAACTAGCTGGTTGGATGGCAGGCATGTTGTATTTGGA
AAGGTGCTATCGGTGATGGATGTAGTTTACAAGGTTGAAGCTGAAGGGA
back to top