CF832450

Overview
NameCF832450
Unique NameCF832450
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length748
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF832450_ssr57 microsatellite CF832450_ssr57:57..66. BLAST: Citrus ESTs to Prunus persica proteins V1
CF832450_ssr221 microsatellite CF832450_ssr221:221..232. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig5660 contig Csv1_Contig5660:385..1132. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832450 vs. ExPASy Swiss-Prot
Match: H2B_GOSHI (Histone H2B OS=Gossypium hirsutum GN=HIS2B PE=2 SV=3)

HSP 1 Score: 180.259 bits (456), Expect = 1.002e-44
Identity = 93/103 (90.29%), Postives = 95/103 (92.23%), Query Frame = 2
Query:  212 SGDXXXXXXXXSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 520
            +GD        S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct:   45 AGDKKKKRVKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 147          
BLAST of CF832450 vs. ExPASy Swiss-Prot
Match: H2B3_SOLLC (Histone H2B.3 (Fragment) OS=Solanum lycopersicum GN=H2B-3 PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.231e-44
Identity = 92/103 (89.32%), Postives = 95/103 (92.23%), Query Frame = 2
Query:  212 SGDXXXXXXXXSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 520
            +GD        ++ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct:   35 AGDKKKKRSKKAVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 137          
BLAST of CF832450 vs. ExPASy Swiss-Prot
Match: H2B11_ARATH (Histone H2B.11 OS=Arabidopsis thaliana GN=At5g59910 PE=1 SV=5)

HSP 1 Score: 178.718 bits (452), Expect = 2.914e-44
Identity = 92/102 (90.20%), Postives = 94/102 (92.16%), Query Frame = 2
Query:  215 GDXXXXXXXXSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 520
            GD        S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct:   49 GDKKKKMKKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 150          
BLAST of CF832450 vs. ExPASy Swiss-Prot
Match: H2B3_MEDTR (Probable histone H2B.3 OS=Medicago truncatula PE=3 SV=3)

HSP 1 Score: 177.563 bits (449), Expect = 6.492e-44
Identity = 91/103 (88.35%), Postives = 94/103 (91.26%), Query Frame = 2
Query:  212 SGDXXXXXXXXSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 520
            S D        S+ETYKIYIFKVLKQVHPDIG+SSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct:   36 SSDKKKKRTKKSVETYKIYIFKVLKQVHPDIGVSSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 138          
BLAST of CF832450 vs. ExPASy Swiss-Prot
Match: H2B1_MEDTR (Probable histone H2B.1 OS=Medicago truncatula PE=3 SV=3)

HSP 1 Score: 177.563 bits (449), Expect = 6.492e-44
Identity = 91/103 (88.35%), Postives = 95/103 (92.23%), Query Frame = 2
Query:  212 SGDXXXXXXXXSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 520
            +G+        S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct:   46 AGEKKKKRSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 148          
BLAST of CF832450 vs. ExPASy Swiss-Prot
Match: H2B1_ARATH (Histone H2B.1 OS=Arabidopsis thaliana GN=At1g07790 PE=1 SV=3)

HSP 1 Score: 176.792 bits (447), Expect = 1.107e-43
Identity = 90/103 (87.38%), Postives = 95/103 (92.23%), Query Frame = 2
Query:  212 SGDXXXXXXXXSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 520
            +GD        ++ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+S+LARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct:   46 AGDKKKKRSKKNVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 148          
BLAST of CF832450 vs. ExPASy Swiss-Prot
Match: H2B_CAPAN (Histone H2B OS=Capsicum annuum GN=HIS2B PE=2 SV=3)

HSP 1 Score: 176.407 bits (446), Expect = 1.446e-43
Identity = 90/92 (97.83%), Postives = 92/92 (100.00%), Query Frame = 2
Query:  245 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 520
            SIETYKIYIFKVLKQVHPDIGISSK+MGIMNSFINDIFEKLAQE+SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct:   54 SIETYKIYIFKVLKQVHPDIGISSKSMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145          
BLAST of CF832450 vs. ExPASy Swiss-Prot
Match: H2B7_ARATH (Histone H2B.7 OS=Arabidopsis thaliana GN=At3g46030 PE=1 SV=3)

HSP 1 Score: 175.637 bits (444), Expect = 2.467e-43
Identity = 90/102 (88.24%), Postives = 93/102 (91.18%), Query Frame = 2
Query:  215 GDXXXXXXXXSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 520
            GD        S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLA E+S+LARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct:   44 GDKKKKMKKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145          
BLAST of CF832450 vs. ExPASy Swiss-Prot
Match: H2B6_ARATH (Histone H2B.6 OS=Arabidopsis thaliana GN=H2B PE=1 SV=3)

HSP 1 Score: 175.637 bits (444), Expect = 2.467e-43
Identity = 90/102 (88.24%), Postives = 93/102 (91.18%), Query Frame = 2
Query:  215 GDXXXXXXXXSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 520
            GD        S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLA E+S+LARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct:   49 GDKKKKMKKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 150          
BLAST of CF832450 vs. ExPASy Swiss-Prot
Match: H2B3_ARATH (Histone H2B.3 OS=Arabidopsis thaliana GN=At2g28720 PE=1 SV=3)

HSP 1 Score: 175.637 bits (444), Expect = 2.467e-43
Identity = 90/92 (97.83%), Postives = 91/92 (98.91%), Query Frame = 2
Query:  245 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 520
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct:   60 STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 151          
The following BLAST results are available for this feature:
BLAST of CF832450 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 205
Match NameE-valueIdentityDescription
H2B_GOSHI1.002e-4490.29Histone H2B OS=Gossypium hirsutum GN=HIS2B PE=2 SV... [more]
H2B3_SOLLC2.231e-4489.32Histone H2B.3 (Fragment) OS=Solanum lycopersicum G... [more]
H2B11_ARATH2.914e-4490.20Histone H2B.11 OS=Arabidopsis thaliana GN=At5g5991... [more]
H2B3_MEDTR6.492e-4488.35Probable histone H2B.3 OS=Medicago truncatula PE=3... [more]
H2B1_MEDTR6.492e-4488.35Probable histone H2B.1 OS=Medicago truncatula PE=3... [more]
H2B1_ARATH1.107e-4387.38Histone H2B.1 OS=Arabidopsis thaliana GN=At1g07790... [more]
H2B_CAPAN1.446e-4397.83Histone H2B OS=Capsicum annuum GN=HIS2B PE=2 SV=3[more]
H2B7_ARATH2.467e-4388.24Histone H2B.7 OS=Arabidopsis thaliana GN=At3g46030... [more]
H2B6_ARATH2.467e-4388.24Histone H2B.6 OS=Arabidopsis thaliana GN=H2B PE=1 ... [more]
H2B3_ARATH2.467e-4397.83Histone H2B.3 OS=Arabidopsis thaliana GN=At2g28720... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01O02_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01O02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832450 ID=CF832450|Name=CF832450|organism=Citrus sinensis|type=EST|length=748bp
TTTACTCTTATCGTTTCGAAGTAAAAGGAAAAGAAAATATCTACAAGCCT
TGCCTTTCTCTCTCTCTACCAAACCGAAATTAATGGCACCAAAGGCGGAG
AAGAAGCCGGCTGAGAAGAAGCCAGCGGAGGAGAAGAAGACATCGGTGGC
CGAGAAGGCGCCGGCGGAGAAGAAGCCGAAGGCCGGCAAGAAGCTTCCCA
AAGAAGCCGCCTCTGGCGACAAGAAGAAGAAGCGCGCGAAGAAGAGCATC
GAGACGTACAAGATTTACATCTTCAAAGTCCTGAAGCAGGTACATCCCGA
TATCGGAATCTCGAGCAAGGCCATGGGAATCATGAACAGTTTCATCAACG
ATATTTTCGAGAAGCTTGCCCAGGAAGCTTCTAGGCTTGCAAGGTACAAT
AAGAAGCCGACGATTACATCTCGGGAAATTCAGACCGCTGTGAGACTTGT
ACTTCCTGGTGAGCTGGCTAAGCACGCTGTTTCTGAGGGTACCAAAGCTG
TTACTAAGTTTACTTCTTCTTGAAGGAAGTTTGTTGCATCGGTCGGTGAA
TTCGGGTGTTATGTGATTTGTGTAGTTAGTAGTTTAGGCCTTTAATTTTA
CTAGATGAAGTCGTTTTTATGTTTTGTGTTTTCAAATCTTTGGTGGATTT
TTAGGGTTTGTTTGGATGTACTAGAAATTTGGACCTGATCCAGGTGATGT
GCATGTTCATTATGTTAGAATATGAAAATGAAATATGATTTCGGAAAG
back to top