CF832451

Overview
NameCF832451
Unique NameCF832451
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length866
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF832451 vs. ExPASy Swiss-Prot
Match: C72A1_CATRO (Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.694e-73
Identity = 123/201 (61.19%), Postives = 162/201 (80.60%), Query Frame = -3
Query:  262 VIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPNYDGLNHLKIVQMILYEVLRLYPPVTVLSRSVLKETKLGNLTLPAGVQIGLPMILVHQDPELWGYDAVEFKPERFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMAMAMILQNYSFELSPSYVHAPTAVPTLHPELGTQLILRKL 864
            VIEECKLFYFAGQETT VLL WT +LLSKH +WQERAR+EVLQ FG NKP ++ LNHLK V MILYEVLRLYPPV  L++ V K+TKLG+ T+PAG Q+ LP +++H++  +WG DA+EF P RF +G++ A KN V+Y PF+ GPR+C+GQNFAL++AK+ +AMILQ + F+++PSYVHAP  + T+ P+ G+ +I +KL
Sbjct:  322 VIEECKLFYFAGQETTGVLLTWTTILLSKHPEWQERAREEVLQAFGKNKPEFERLNHLKYVSMILYEVLRLYPPVIDLTKIVHKDTKLGSYTIPAGTQVMLPTVMLHREKSIWGEDAMEFNPMRFVDGVANATKNNVTYLPFSWGPRVCLGQNFALLQAKLGLAMILQRFKFDVAPSYVHAPFTILTVQPQFGSHVIYKKL 522          
BLAST of CF832451 vs. ExPASy Swiss-Prot
Match: CP3AT_PIG (Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.660e-28
Identity = 64/168 (38.10%), Postives = 102/168 (60.71%), Query Frame = -3
Query:  346 LFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKP-NYDGLNHLKIVQMILYEVLRLYPPVTVLSRSVLKETKLGNLTLPAGVQIGLPMILVHQDPELWGYDAVEFKPERFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMAMAMILQNYSFE 846
            +F FAG ETTS  L+     L+ H D Q++ ++E+   F N  P  YD L  ++ + M++ E LRLYP    L R+  K+ ++  + +P G  + +P+ ++H+DP+LW  +  EF+PERF++   K   N  +Y PF  GPR C+G  FAL+  K+A+  +LQN+SF+
Sbjct:  301 IFIFAGYETTSSALSLLAYELATHPDVQQKLQEEIEATFPNKAPPTYDALAQMEYLDMVVNETLRLYPIAARLERACKKDVEIHGVFVPKGTVVVVPVFVLHRDPDLWP-EPEEFRPERFSKK-HKDTINPYTYLPFGTGPRNCIGMRFALMNMKLALVRVLQNFSFK 466          
BLAST of CF832451 vs. ExPASy Swiss-Prot
Match: CP3AO_SHEEP (Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.660e-28
Identity = 61/168 (36.31%), Postives = 106/168 (63.10%), Query Frame = -3
Query:  346 LFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKP-NYDGLNHLKIVQMILYEVLRLYPPVTVLSRSVLKETKLGNLTLPAGVQIGLPMILVHQDPELWGYDAVEFKPERFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMAMAMILQNYSFE 846
            +F FAG ETTS  L++ + +L+ H D Q++ ++E+   F N  P  YD L  ++ + M++ E LR++P    L R   K+ ++  +++P G  + +P+ ++H+DP+LW  +  EF+PERF++  +K + N   Y PF  GPR C+G  FA++  K+A+  +LQN+SF+
Sbjct:  301 IFIFAGYETTSNTLSFLLYILATHPDVQQKLQEEIDATFPNKAPPTYDVLAQMEYLDMVVNETLRMFPIAVRLDRLCKKDVEIHGVSIPKGTAVTVPIFVLHRDPQLWP-EPEEFRPERFSKK-NKDSINPYVYLPFGTGPRNCIGMRFAIMNMKLAIVRVLQNFSFK 466          
BLAST of CF832451 vs. ExPASy Swiss-Prot
Match: C13A2_CAEEL (Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.832e-28
Identity = 62/174 (35.63%), Postives = 106/174 (60.92%), Query Frame = -3
Query:  346 VIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPNYDGLNHLKIVQMILYEVLRLYPPVTVL-SRSVLKETKLGNLTLPAGVQIGLPMILVHQDPELWGYDAVEFKPERFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMAMAMILQNYSFE 864
            V+ +C LF   G +TT++ L++   LL+ +   QE+  +E+ + FG ++  ++ L  LK +  ++ E LRLYP  ++  SR  +K T +  + + AGV + +    +H DPELWG D  EFKPER++    +  +++ +Y PF LGPR C+G   A++E K+ +  +L+NY+FE
Sbjct:  313 VVGQCFLFLIGGFDTTALSLSYVTYLLAVNPKIQEKVIEEIAREFGTSEVEFEKLGRLKYMDCVIKEALRLYPLASISNSRKCMKTTTVNGVKIEAGVYVQMDTWSLHYDPELWGEDVKEFKPERWS--TDEPLEHKGAYLPFGLGPRQCIGMRLAIMEQKILLTHLLKNYTFE 484          
BLAST of CF832451 vs. ExPASy Swiss-Prot
Match: CP3AC_CANFA (Cytochrome P450 3A12 OS=Canis familiaris GN=CYP3A12 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 4.831e-28
Identity = 64/174 (36.78%), Postives = 103/174 (59.20%), Query Frame = -3
Query:  346 VIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNK-PNYDGLNHLKIVQMILYEVLRLYPPVTVLSRSVLKETKLGNLTLPAGVQIGLPMILVHQDPELWGYDAVEFKPERFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMAMAMILQNYSFE 864
            ++ +  +F FAG ETTS  L++ M  L+ H D Q++ ++E+   F N   P YD L  ++ + M+L E LRLYP    L R   K+ ++  + +P G  + +P   +H+D  LW  +  EF+PERF+   +K + N  +Y PF  GPR C+G  FA++  K+A+  +LQN+SF+
Sbjct:  295 LVAQSIIFIFAGYETTSTSLSFLMYELATHPDVQQKLQEEIDATFPNKALPTYDALVQMEYLDMVLNETLRLYPIAGRLERVCKKDVEISGVFIPKGTVVMVPTFTLHRDQSLWP-EPEEFRPERFSRK-NKDSINPYTYLPFGTGPRNCIGMRFAIMNMKLALVRVLQNFSFK 466          
BLAST of CF832451 vs. ExPASy Swiss-Prot
Match: C13A7_CAEEL (Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.076e-27
Identity = 64/180 (35.56%), Postives = 110/180 (61.11%), Query Frame = -3
Query:  328 VIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPNYDGLNHLKIVQMILYEVLRLYPPVTVL-SRSVLKETKLGNLTLPAGVQIGLPMILVHQDPELWGYDAVEFKPERFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMAMAMILQNYSFELSPSYV 864
            +I +  +F  AG +TT++ L+++  LL+ H + Q++ ++EV +   + +  +D L+ LK ++ ++ E LRLYP  +++ +R  LK T +  + + AG  I +    +H DP++WG D  EFKPER+  G  +    +  Y PF +GPRIC+G   A++E KM +  IL+NY+FE +P  V
Sbjct:  316 IIGQLFVFLLAGYDTTALSLSYSSYLLATHPEIQKKLQEEVDRECPDPEVTFDQLSKLKYLECVVKEALRLYPLASLVHNRKCLKTTNVLGMEIEAGTNINVDTWSLHHDPKVWGDDVNEFKPERWESG-DELFFAKGGYLPFGMGPRICIGMRLAMMEMKMLLTNILKNYTFETTPETV 494          
BLAST of CF832451 vs. ExPASy Swiss-Prot
Match: CP3AJ_CAPAE (Cytochrome P450 3A19 (Fragment) OS=Capra aegagrus GN=CYP3A19 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.836e-27
Identity = 62/173 (35.84%), Postives = 103/173 (59.54%), Query Frame = -3
Query:  349 VIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKP-NYDGLNHLKIVQMILYEVLRLYPPVTVLSRSVLKETKLGNLTLPAGVQIGLPMILVHQDPELWGYDAVEFKPERFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMAMAMILQNYSF 864
            ++ +  +F F G ETTS  L++ +  L+ H D Q++ ++E+   F N  P  YD L  ++ + M++ E LR++P    L R   K+ ++  +++P G  + +P+ ++H +PE W  +  EF+PERF++  +K   N   Y PF  GPR CVG  FAL+  K+A+  ILQN+SF
Sbjct:    6 LVAQTTIFIFGGYETTSTSLSFIIYELATHPDVQQKLQEEIDATFPNKAPPTYDALVQMEYLDMVVNETLRMFPIAGRLERLCKKDVEIHGVSIPKGTTVMVPLFVLHNNPEFWP-EPEEFRPERFSKK-NKDGINPYVYLPFGTGPRNCVGMRFALMNIKLALVRILQNFSF 176          
BLAST of CF832451 vs. ExPASy Swiss-Prot
Match: CP3AS_BOVIN (Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.131e-27
Identity = 61/174 (35.06%), Postives = 105/174 (60.34%), Query Frame = -3
Query:  346 VIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKP-NYDGLNHLKIVQMILYEVLRLYPPVTVLSRSVLKETKLGNLTLPAGVQIGLPMILVHQDPELWGYDAVEFKPERFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMAMAMILQNYSFE 864
            ++ +  +F F G ETTS  L++ +  L+ H   Q++ ++E+   F N  P  YD L  ++ + M++ E LR++P    L R   K+ ++  +T+P G  + +P+ ++H +PELW  +  EF+PERF++  +K + N   Y PF  GPR C+G  FA++  K+A+  ILQN+SF+
Sbjct:  295 LVAQSTIFIFGGYETTSSTLSFIIYELTTHPHVQQKLQEEIDATFPNKAPPTYDALVQMEYLDMVVNETLRMFPIAGRLERVCKKDVEIHGVTIPKGTTVLVPLFVLHNNPELWP-EPEEFRPERFSKN-NKDSINPYVYLPFGTGPRNCLGMRFAIMNIKLALVRILQNFSFK 466          
BLAST of CF832451 vs. ExPASy Swiss-Prot
Match: CP3AG_MOUSE (Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.131e-27
Identity = 62/168 (36.90%), Postives = 103/168 (61.31%), Query Frame = -3
Query:  346 LFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKP-NYDGLNHLKIVQMILYEVLRLYPPVTVLSRSVLKETKLGNLTLPAGVQIGLPMILVHQDPELWGYDAVEFKPERFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMAMAMILQNYSFE 846
            +F FAG ETTS +L++T+  L+ H D Q++ ++E+ +   N  P  YD +  ++ + M+L E LRLYP    L R   K+ ++  + +P G  + +P  ++H DP+ W  +  EF+PERF++  +K + +   Y PF  GPR C+G  FAL+  K+A+  +LQN+SF+
Sbjct:  302 IFIFAGYETTSSILSFTVYSLATHPDIQKKLQEEIDEALPNKAPPTYDTVMAMEYLDMVLNETLRLYPITNRLQRVCKKDVEINGIYIPKGSTVIIPSYVLHHDPQHWP-EPEEFQPERFSKE-NKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALIKVLQNFSFQ 467          
BLAST of CF832451 vs. ExPASy Swiss-Prot
Match: C13AA_CAEEL (Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=2 SV=3)

HSP 1 Score: 122.094 bits (305), Expect = 4.090e-27
Identity = 64/175 (36.57%), Postives = 104/175 (59.43%), Query Frame = -3
Query:  343 VIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQERARQEVLQVFGNNKPNYDGLNHLKIVQMILYEVLRLYPPVTVL-SRSVLKETKLGNLTLPAGVQIGLPMILVHQDPELWGYDAVEFKPERFAEGISKAAKNQVSYFPFALGPRICVGQNFALVEAKMAMAMILQNYSFEL 864
            ++ +C +F  AG +TT++ L++T  LL+ H + Q++ ++E+ +       ++D L+ LK +  I+ E LRLYP  T+  SR  ++ TKLGN+ +  G  + +    +H D ++WG DA EFKPER+ +        +  Y  F LGPR CVG   A +E KM +A IL+ Y+FE+
Sbjct:  316 IVGQCLVFLIAGFDTTALSLSYTTFLLATHPEVQKKLQEEIERECIEPSISFDHLSKLKYMDCIIKETLRLYPLGTMANSRRCMRATKLGNVEVEVGTMVQVDTWSLHTDTKIWGDDAKEFKPERWLDPNCDQVFQKGGYISFGLGPRQCVGMRLAYMEEKMLLAHILRKYTFEV 490          
The following BLAST results are available for this feature:
BLAST of CF832451 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 457
Match NameE-valueIdentityDescription
C72A1_CATRO1.694e-7361.19Secologanin synthase OS=Catharanthus roseus GN=CYP... [more]
CP3AT_PIG1.660e-2838.10Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2... [more]
CP3AO_SHEEP1.660e-2836.31Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2... [more]
C13A2_CAEEL2.832e-2835.63Putative cytochrome P450 CYP13A2 OS=Caenorhabditis... [more]
CP3AC_CANFA4.831e-2836.78Cytochrome P450 3A12 OS=Canis familiaris GN=CYP3A1... [more]
C13A7_CAEEL1.076e-2735.56Putative cytochrome P450 CYP13A7 OS=Caenorhabditis... [more]
CP3AJ_CAPAE1.836e-2735.84Cytochrome P450 3A19 (Fragment) OS=Capra aegagrus ... [more]
CP3AS_BOVIN3.131e-2735.06Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2... [more]
CP3AG_MOUSE3.131e-2736.90Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE... [more]
C13AA_CAEEL4.090e-2736.57Putative cytochrome P450 CYP13A10 OS=Caenorhabditi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01O03_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01O03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832451 ID=CF832451|Name=CF832451|organism=Citrus sinensis|type=EST|length=866bp
TTTTTTTTTTTTTTACCCAGCATTAATGCTCTAATTCTAATCATGGTATT
ATAAAATTTTCCAATGTGGGGAAACATCTTTACTCTAAATAAAACTAGAG
TTGTGTTGAGCTCAATTTAAAAATCTAAACAGCTCTTGTCTAAGCTTTGA
ATCTCAATACAAAATTAAATACATTAAACTTCATTATAAAAGAGTCTACA
TTGGCATCATGCTAATCTTATTGACAATATATAGTTGCCGGTATTAATTA
TTTTTGCACCTTAGTTTCCGTAGAATCAATTGGGTACCCAGTTCCGGATG
AAGGGTTGGAACCGCCGTTGGAGCATGGACATAGGATGGAGACAACTCGA
ATGAGTAGTTTTGAAGAATCATTGCCATGGCCATTTTTGCTTCTACTAGA
GCAAAATTTTGTCCAACACATATCCTAGGACCCAATGCGAATGGGAAATA
TGAAACTTGATTTTTGGCCGCCTTTGAAATTCCTTCCGCAAACCTTTCCG
GCTTAAACTCAACTGCATCGTAACCCCAAAGTTCAGGATCCTGGTGAACT
AGGATCATTGGCAAGCCAATTTGAACCCCAGCGGGTAATGTCAAGTTTCC
GAGTTTCGTTTCCTTAAGAACAGATCGACTAAGCACAGTTACAGGCGGAT
AAAGCCTGAGTACCTCGTAAAGTATCATCTGGACAATTTTGAGGTGATTC
AATCCATCATAGTTGGGCTTATTATTGCCAAACACTTGCAAAACCTCTTG
CCTTGCACGTTCTTGCCAATCTTGATGCTTGCTCAATAAGACCATCGTCC
AATTAAGCAAAACAGAGGTAGTCTCTTGGCCGGCAAAGTAAAATAGCTTA
CACTCTTCGATCACAT
back to top