CF832455

Overview
NameCF832455
Unique NameCF832455
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length788
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9906 contig Csv1_Contig9906:709..1496. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832455 vs. ExPASy Swiss-Prot
Match: COMT1_PRUDU (Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.368e-55
Identity = 100/193 (51.81%), Postives = 137/193 (70.98%), Query Frame = -1
Query:  207 RFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 785
            RFN+VFN GM   ++  + KI+E+YKGF+ +T +VDV           +SKYP IKGINFD+PHVI+DA  YPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY ALP++GKV++    LP  PDS+ A++    +D I L   P G+ERT++EF ALA  AGF+G N  C+  N+YV+EF K
Sbjct:  171 RFNKVFNRGMADHSTITMKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSIKGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDVIMLAHNPGGKERTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK 363          
BLAST of CF832455 vs. ExPASy Swiss-Prot
Match: OMT2_CHRAE (Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 2.333e-55
Identity = 99/193 (51.30%), Postives = 137/193 (70.98%), Query Frame = -1
Query:  207 RFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 785
            RFN+VFN GM   ++  + K+ ++Y+GFQ +T LVDV           +SKYP I+ INFD+PHVI+DA  YPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K+L+NCY ALPN+GKV++    LPEVPDS+ A++    +D I +   P G+ERT+KEF ALA  AGF+G    CN  N+Y++EF K
Sbjct:  147 RFNKVFNRGMSDHSTITMKKVFQTYQGFQGLTSLVDVGGGTGATLTMILSKYPTIRCINFDLPHVIEDAPEYPGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKLLKNCYDALPNNGKVILAECILPEVPDSSLATKGVVHIDVITVAHNPGGKERTEKEFEALAKAAGFQGFQVFCNAFNTYIIEFSK 339          
BLAST of CF832455 vs. ExPASy Swiss-Prot
Match: OMT1_CHRAE (Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 2.333e-55
Identity = 99/193 (51.30%), Postives = 137/193 (70.98%), Query Frame = -1
Query:  207 RFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 785
            RFN+VFN GM   ++  + K+ ++Y+GFQ +T LVDV           +SKYP I+ INFD+PHVI+DA  YPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K+L+NCY ALPN+GKV++    LPEVPDS+ A++    +D I +   P G+ERT+KEF ALA  AGF+G    CN  N+Y++EF K
Sbjct:  147 RFNKVFNRGMSDHSTITMKKVFQAYQGFQGLTSLVDVGGGTGATLTMILSKYPTIRCINFDLPHVIEDAPEYPGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKLLKNCYDALPNNGKVILAECILPEVPDSSLATKGVVHIDVITVAHNPGGKERTEKEFEALAKAAGFQGFQVFCNAFNTYIIEFSK 339          
BLAST of CF832455 vs. ExPASy Swiss-Prot
Match: COMT1_MEDSA (Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 3.979e-55
Identity = 100/193 (51.81%), Postives = 134/193 (69.43%), Query Frame = -1
Query:  207 RFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 785
            RFN+VFN GM   ++  + KI+E+Y GF+ +  LVDV           +SKYP IKGINFD+PHVI+DA SYPG+EHVGGDM+  IP+ DA+ MKW+ H++ DE+C+K L+NCY+ALP++GKV+V    LP  PDS+ A++    +D I L   P G+ERT+KEF  LA  AGF+G    CN  N+Y+MEF K
Sbjct:  171 RFNKVFNKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDVIMLAHNPGGKERTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK 363          
BLAST of CF832455 vs. ExPASy Swiss-Prot
Match: OMT1_ARATH (Quercetin 3-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 5.197e-55
Identity = 98/193 (50.78%), Postives = 137/193 (70.98%), Query Frame = -1
Query:  207 RFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 785
            RFN+VFNNGM   ++  + KI+E+YKGF+ +T LVDV           +SKYP++KGINFD+PHVI+DA S+PG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY++LP DGKV++    LPE PDS+ +++    +D I L   P G+ERT+KEF ALA  +GFKGI   C+     ++E  K
Sbjct:  169 RFNKVFNNGMSNHSTITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNLKGINFDLPHVIEDAPSHPGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECILPETPDSSLSTKQVVHVDCIMLAHNPGGKERTEKEFEALAKASGFKGIKVVCDAFGVNLIELLK 361          
BLAST of CF832455 vs. ExPASy Swiss-Prot
Match: COMT1_ROSCH (Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 6.787e-55
Identity = 97/193 (50.26%), Postives = 137/193 (70.98%), Query Frame = -1
Query:  207 RFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 785
            RFN+VFN GM   ++  + KI+E+YKGF+ +T +VDV           +SKYP IKGINFD+PHVI+DA  YPG++HVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY ALP++GKV++    LP  PD++ A++    +D + L   P G+ERT++EF ALA  +GF+GI   CN  N+YV+EF K
Sbjct:  171 RFNKVFNKGMADHSTITMKKILETYKGFEGLTSIVDVGGGTGAVVNMIVSKYPSIKGINFDLPHVIEDAPQYPGVQHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDTSLATKGVVHIDVVMLAHNPGGKERTEQEFEALAKGSGFQGIRVACNAFNTYVIEFLK 363          
BLAST of CF832455 vs. ExPASy Swiss-Prot
Match: COMT1_CLABR (Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 4.399e-54
Identity = 101/193 (52.33%), Postives = 130/193 (67.36%), Query Frame = -1
Query:  207 RFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 785
            RFN+VFN GM   ++  + KI E Y GF+ +  +VDV           ++KYP IKGINFD+PHVI+DA  YPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY ALP  GKV+V    LP  PD + A++    +DAI L   P G+ERT+KEF ALAI AGFKG    C   N+YVMEF K
Sbjct:  176 RFNKVFNRGMSDHSTITMKKIFEMYTGFEALNTIVDVGGGTGAVLSMIVAKYPSIKGINFDLPHVIEDAPIYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPEHGKVIVAECILPLSPDPSLATKGVIHIDAIMLAHNPGGKERTEKEFEALAIGAGFKGFKVACCAFNTYVMEFLK 368          
BLAST of CF832455 vs. ExPASy Swiss-Prot
Match: COMT1_ZINEL (Caffeic acid 3-O-methyltransferase OS=Zinnia elegans PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.504e-54
Identity = 98/193 (50.78%), Postives = 134/193 (69.43%), Query Frame = -1
Query:  207 RFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 785
            RFN+VFN+GM   ++  + KIVE Y GF  +  LVDV            SK+  +KGINFD+PHVI DA++Y G+EHVGGDM++ +P+GDAI MKW+LH++ D +C+++L+NCYK+LP +GKV+V    LPE PD+T A+++   +D I L   P G+ERT+KEF ALA  AGFKG N      N++VMEF K
Sbjct:  162 RFNKVFNSGMFNHSTMTMKKIVELYNGFSGLKTLVDVGGGTGASLNMITSKHKSLKGINFDLPHVIADATTYQGIEHVGGDMFESVPKGDAIFMKWILHDWSDAHCLQVLKNCYKSLPENGKVIVAECILPEAPDTTPATQNVIHIDVIMLAHNPGGKERTEKEFEALAKGAGFKGFNKAACALNTWVMEFCK 354          
BLAST of CF832455 vs. ExPASy Swiss-Prot
Match: COMT1_CATRO (Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.672e-53
Identity = 97/193 (50.26%), Postives = 136/193 (70.47%), Query Frame = -1
Query:  207 RFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 785
            RFN+VFN GM   ++ ++ KI+E Y+GFQ +  +VDV           +SKYP IKGINFD+PHVI+DA SYPG++HVGGDM+  +P+GDAI MKW+ H++ D +C+K L+NC++ALP +GKV++    LPE PDST +++++  +D I L   P G+ERT+KEF ALA  AGF+G    C   NS++ME  K
Sbjct:  171 RFNKVFNQGMSNHSTIIMKKILEIYQGFQGLKTVVDVGGGTGATLNMIVSKYPSIKGINFDLPHVIEDAPSYPGVDHVGGDMFVSVPKGDAIFMKWICHDWSDAHCLKFLKNCHEALPENGKVILAECLLPEAPDSTLSTQNTVHVDVIMLAHNPGGKERTEKEFEALAKGAGFRGFIKVCCAYNSWIMELLK 363          
BLAST of CF832455 vs. ExPASy Swiss-Prot
Match: COMT1_OCIBA (Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.852e-53
Identity = 97/193 (50.26%), Postives = 131/193 (67.88%), Query Frame = -1
Query:  207 RFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 785
            RFN+VFN GM   ++  + KI+E+Y GF  +  +VDV           +SKYP IKGINFD+PHVI+DA SYPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY ALP +GKV++    LPE PD+  A+++   +D I L   P G+ERT+KEF  LA  AGFK  N  C   N+++ME  K
Sbjct:  169 RFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIVSKYPSIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYDALPQNGKVILAECVLPEAPDTGLATKNVVHIDVIMLAHNPGGKERTEKEFQGLAKAAGFKQFNKACCAYNTWIMELLK 361          
The following BLAST results are available for this feature:
BLAST of CF832455 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
COMT1_PRUDU1.368e-5551.81Caffeic acid 3-O-methyltransferase OS=Prunus dulci... [more]
OMT2_CHRAE2.333e-5551.30Quercetin 3-O-methyltransferase 2 OS=Chrysospleniu... [more]
OMT1_CHRAE2.333e-5551.30Quercetin 3-O-methyltransferase 1 OS=Chrysospleniu... [more]
COMT1_MEDSA3.979e-5551.81Caffeic acid 3-O-methyltransferase OS=Medicago sat... [more]
OMT1_ARATH5.197e-5550.78Quercetin 3-O-methyltransferase 1 OS=Arabidopsis t... [more]
COMT1_ROSCH6.787e-5550.26Caffeic acid 3-O-methyltransferase OS=Rosa chinens... [more]
COMT1_CLABR4.399e-5452.33Caffeic acid 3-O-methyltransferase OS=Clarkia brew... [more]
COMT1_ZINEL7.504e-5450.78Caffeic acid 3-O-methyltransferase OS=Zinnia elega... [more]
COMT1_CATRO1.672e-5350.26Caffeic acid 3-O-methyltransferase OS=Catharanthus... [more]
COMT1_OCIBA2.852e-5350.26Caffeic acid 3-O-methyltransferase 1 OS=Ocimum bas... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01O06_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01O06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832455 ID=CF832455|Name=CF832455|organism=Citrus sinensis|type=EST|length=788bp
TTTTTTTTTTTTTTTTTACCAAACACAAACAGGACTTATATTCCTGTTCA
CACAAAAGCATTACATAAGAAGTTCCCGCGAGCCATAAAGGCCAAACAAA
ACAGAAAGTTACAGAAAAGAAAATGGAGTATCGACACTCCAAATTAAAAT
TGAGAAGATGCATCTTTCTGATAAAGAAAGAATGAAGCAATCTAGCTTCA
AAGTTACTTGTAGAATTCCATGACATAGGAATTGCAAACGTTACATTCAA
AGTTGATACCCTTAAATCCAGCTTCGATTGCCAATGCAGTGAACTCCTTT
TTGGTCCGCTCCCTTCCATGAGGAATTTGGATTAAAAAAATTGCATCTAA
AATGAAGGAATCCCTTGAAGCCTCGGTACTGTCAGGCACTTCTGGCAACG
TTGAGTTAATAACAAGTACCTTTCCATCATTTGGAAGAGCTTTGTAACAA
TTCCTCAGTATCTTTATGCAATTCTCATCATCAAAATTATGAAGCATCCA
CTTCATTAAAATGGCATCCCCCTCTGGAATTTTTTGGTACATATCTCCGC
CAACATGTTCCATGCCGGGATAAGATGAGGCATCTTTTATAACATGAGGT
ACGTCAAAATTAATACCCTTAATATGAGGGTATTTGGAAATTATGGTCGC
AAGGGTGATTCCTAAACCACCGCCAACGTCAACAAGGCGCGTAATATTCT
GAAAGCCTTTGTAGGATTCTACAATCTTATTGATTACAAAAGAAGTCTGG
CCGATCATTCCATTGTTGAAAACTTCATTGAACCTGGA
back to top