CF832457

Overview
NameCF832457
Unique NameCF832457
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length549
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8246 contig Csv1_Contig8246:546..1095. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832457 vs. ExPASy Swiss-Prot
Match: CATA1_NICPL (Catalase isozyme 1 (Fragment) OS=Nicotiana plumbaginifolia GN=CAT1 PE=2 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 1.743e-51
Identity = 88/111 (79.28%), Postives = 102/111 (91.89%), Query Frame = -2
Query:  216 NFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI 548
            NFMHRDEE+DYFPSRYDP RHAE+YPIPS + TG+REK  I+KENNFKQPGERYRS+ PDRQERF+ RW++ L DPR+T+E+RSIW+SYWSQAD+SLGQKLASRLNVRPSI
Sbjct:  375 NFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI 485          
BLAST of CF832457 vs. ExPASy Swiss-Prot
Match: CATA2_GOSHI (Catalase isozyme 2 OS=Gossypium hirsutum GN=CAT2 PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 5.072e-51
Identity = 90/111 (81.08%), Postives = 103/111 (92.79%), Query Frame = -2
Query:  216 NFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI 548
            NFMHRDEEV+YFPSRYDP RHAE++PIPS V++G+REK  I KENNFKQPGERYRS++ DRQERF+NRWI AL DPRVTHE+RSIW+SYWSQAD+SLGQK+ASRLNVRPSI
Sbjct:  382 NFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI 492          
BLAST of CF832457 vs. ExPASy Swiss-Prot
Match: CATA3_NICPL (Catalase isozyme 3 OS=Nicotiana plumbaginifolia GN=CAT3 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 8.652e-51
Identity = 88/111 (79.28%), Postives = 102/111 (91.89%), Query Frame = -2
Query:  216 NFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI 548
            NFMHRDEEV+YFPSR+DP RHAE+YPIP  V+TG+R+K  IEKENNFKQPGERYRSWAPDRQERF+ RW+ AL DPRVTHE+RSIW SYWSQAD++LGQK+ASRLNVRP++
Sbjct:  382 NFMHRDEEVNYFPSRFDPCRHAEQYPIPPCVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWFSYWSQADKTLGQKIASRLNVRPTM 492          
BLAST of CF832457 vs. ExPASy Swiss-Prot
Match: CATA1_GOSHI (Catalase isozyme 1 OS=Gossypium hirsutum GN=CAT1 PE=2 SV=2)

HSP 1 Score: 199.134 bits (505), Expect = 1.130e-50
Identity = 90/111 (81.08%), Postives = 99/111 (89.19%), Query Frame = -2
Query:  216 NFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI 548
            NFMHRDEE++YFPSRYDP RHAE +PIP  V TGRREK  IEKENNFKQPGERYRSWA DRQERF+ RW+ AL DPRVTHE+RSIW+SYWSQAD+S+GQKLAS LNVRPSI
Sbjct:  382 NFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASLLNVRPSI 492          
BLAST of CF832457 vs. ExPASy Swiss-Prot
Match: CATA_AVIMR (Catalase OS=Avicennia marina PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 2.517e-50
Identity = 89/111 (80.18%), Postives = 102/111 (91.89%), Query Frame = -2
Query:  216 NFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI 548
            NFMHRDEEVDYFPS+YDPTRHAER+PIP+ VITGRR++  IEKE+NFKQ G+RYRSWAPDRQERFL RW+ AL DPR+T E+RSIWVSYWSQAD+S GQKLASRLNVRP++
Sbjct:  382 NFMHRDEEVDYFPSKYDPTRHAERHPIPNAVITGRRDRRVIEKEDNFKQAGDRYRSWAPDRQERFLRRWVDALSDPRLTLEIRSIWVSYWSQADKSFGQKLASRLNVRPTM 492          
BLAST of CF832457 vs. ExPASy Swiss-Prot
Match: CATA4_SOYBN (Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 5.608e-50
Identity = 86/111 (77.48%), Postives = 99/111 (89.19%), Query Frame = -2
Query:  216 NFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI 548
            NF+HRDEEV+YFPSRYDP RHAER+PIP  + +GRREK  IEKENNFKQPGERYRSWAPDRQ+RF  RW+ AL DPRVTHE+RS+W+SYWSQADRSLGQK+AS L+ RP+I
Sbjct:  382 NFIHRDEEVNYFPSRYDPVRHAERFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSTRPNI 492          
BLAST of CF832457 vs. ExPASy Swiss-Prot
Match: CATA2_SOLLC (Catalase isozyme 2 OS=Solanum lycopersicum GN=CAT2 PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 5.608e-50
Identity = 87/111 (78.38%), Postives = 101/111 (90.99%), Query Frame = -2
Query:  216 NFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI 548
            NFMHRDEE+DYFPSRYD  RHAE YPIPS V +G+REK  I+KENNFKQPGERYRS+ PDRQERF+ RW++AL DPR+T+E+RSIW++YWSQAD+SLGQKLASRLNVRPSI
Sbjct:  382 NFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPSI 492          
BLAST of CF832457 vs. ExPASy Swiss-Prot
Match: CATA1_CUCPE (Catalase isozyme 1 OS=Cucurbita pepo GN=CAT1 PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 5.608e-50
Identity = 88/111 (79.28%), Postives = 99/111 (89.19%), Query Frame = -2
Query:  216 NFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI 548
            NFMHRDEEV+YFPSR+DP+RHAERYP P  V +G+RE+  IEKENNFK+PGERYRSW PDRQERF+ RW+ AL D RVTHE+RSIW+SYWSQADRSLGQKLAS LNVRPSI
Sbjct:  382 NFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPSI 492          
BLAST of CF832457 vs. ExPASy Swiss-Prot
Match: CATA_SOLAP (Catalase OS=Soldanella alpina PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 9.566e-50
Identity = 86/111 (77.48%), Postives = 103/111 (92.79%), Query Frame = -2
Query:  216 NFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI 548
            NFMHRDEEV+YFPSR+DP RHAER+PIP  V+TG+R++  IEKENNFKQPGERYR++APDRQERF+ RW+ AL DPRVTHE+RSIW+SYW+QAD+SLGQKLASRLNVRP++
Sbjct:  382 NFMHRDEEVNYFPSRFDPVRHAERHPIPPPVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM 492          
BLAST of CF832457 vs. ExPASy Swiss-Prot
Match: CATA_PHAAU (Catalase OS=Phaseolus aureus PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 9.566e-50
Identity = 85/111 (76.58%), Postives = 100/111 (90.09%), Query Frame = -2
Query:  216 NFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI 548
            NF+HRDEEV+YFPSRYDP RHAE++PIP  V +GRREK  IEKENNFKQ GER+RSWAPDRQ+RF+ RW+ AL DPRVTHE+RS+W+SYWSQADRSLGQK+AS LN+RP+I
Sbjct:  382 NFIHRDEEVNYFPSRYDPVRHAEKFPIPPAVFSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI 492          
The following BLAST results are available for this feature:
BLAST of CF832457 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
CATA1_NICPL1.743e-5179.28Catalase isozyme 1 (Fragment) OS=Nicotiana plumbag... [more]
CATA2_GOSHI5.072e-5181.08Catalase isozyme 2 OS=Gossypium hirsutum GN=CAT2 P... [more]
CATA3_NICPL8.652e-5179.28Catalase isozyme 3 OS=Nicotiana plumbaginifolia GN... [more]
CATA1_GOSHI1.130e-5081.08Catalase isozyme 1 OS=Gossypium hirsutum GN=CAT1 P... [more]
CATA_AVIMR2.517e-5080.18Catalase OS=Avicennia marina PE=2 SV=1[more]
CATA4_SOYBN5.608e-5077.48Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1[more]
CATA2_SOLLC5.608e-5078.38Catalase isozyme 2 OS=Solanum lycopersicum GN=CAT2... [more]
CATA1_CUCPE5.608e-5079.28Catalase isozyme 1 OS=Cucurbita pepo GN=CAT1 PE=2 ... [more]
CATA_SOLAP9.566e-5077.48Catalase OS=Soldanella alpina PE=2 SV=1[more]
CATA_PHAAU9.566e-5076.58Catalase OS=Phaseolus aureus PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01O07_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01O07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832457 ID=CF832457|Name=CF832457|organism=Citrus sinensis|type=EST|length=549bp
TTTTTTTTTTTTTTTTGAACTTCTAAAACAGACTTTTATTAATTGCAACA
ACAGGAAAAGAGTCACATAACATGCAAGTTTATTTTCTATATTACAATAT
ACAACAGCAAACATAGGATCGAAATTCTTCACATAGCTGCACCCTTGGTG
TTCACTCCTTGCTCACTCTTGGCAAGTCAAAAGCATCCAGTGTTCCAGTT
CAAGTGACACCTTCAAATGCTTGGCCTCACATTGAGACGAGAAGCTAGCT
TCTGACCCAGAGATCTGTCGGCCTGAGACCAGTAAGAGACCCATATGCTG
CGAACCTCATGGGTGACACGTGGGTCACATAAAGCCTTAATCCATCGATT
AAGGAACCTCTCTTGCCTGTCTGGGGCCCAGGATCGGTATCTCTCTCCAG
GCTGCTTGAAGTTGTTTTCCTTCTCAATGCAAGCCTTCTCACGCCTTCCT
GTAATTACATCAGAAGGAATGGGATATCTCTCAGCATGACGAGTAGGATC
ATACCTCGAAGGAAAGTAATCGACCTCCTCATCCCTGTGCATGAAATTC
back to top