CF832464

Overview
NameCF832464
Unique NameCF832464
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4944 contig Csv1_Contig4944:247..941. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832464 vs. ExPASy Swiss-Prot
Match: 12KD_FRAAN (Auxin-repressed 12.5 kDa protein OS=Fragaria ananassa PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.080e-26
Identity = 63/121 (52.07%), Postives = 77/121 (63.64%), Query Frame = 2
Query:   35 MLEKLWAYVVAGPQPDRGLGRLRKITTTPLAVKEGGEAESSSGKFQRSLSMXXXXXXXXXXXXXXXXXXXRKDNVWRSVFHPGSNLATRGIGAEVFDKPTHPNSPTVYDWLYSGETRSKHH 397
            +L+KLW  +VAGPQP+RGLG LRK+   PL +K+ GE+           S                    RKDNVWRSVFHPGSNL+++ +G +VFD P  PNSPTVYDW+YSGETRSKHH
Sbjct:    3 LLDKLWDDIVAGPQPERGLGMLRKVPQ-PLNLKDEGES-----------SKITMPTTPTTPVTPTTPISARKDNVWRSVFHPGSNLSSKTMGNQVFDSP-QPNSPTVYDWMYSGETRSKHH 110          
The following BLAST results are available for this feature:
BLAST of CF832464 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
12KD_FRAAN1.080e-2652.07Auxin-repressed 12.5 kDa protein OS=Fragaria anana... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01O10_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01O10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832464 ID=CF832464|Name=CF832464|organism=Citrus sinensis|type=EST|length=696bp
TTTAGAAACTACCATTTAAATTGTAAATTTAAAGATGCTAGAGAAGCTTT
GGGCCTATGTTGTGGCAGGGCCTCAGCCTGATCGTGGCCTTGGCAGGCTG
AGGAAAATCACCACAACACCCTTAGCAGTCAAAGAGGGTGGTGAGGCGGA
GTCGTCGTCGGGCAAGTTCCAGAGGTCTCTGTCAATGCCAGCGAGTCCAG
GGGCACCGTCGACGCCAGTGACGCCGACGACGCCGCTGTCGGCGCGTAAG
GACAACGTGTGGAGGAGCGTGTTTCACCCCGGTAGCAACCTTGCTACTAG
GGGTATCGGTGCAGAGGTCTTTGACAAGCCCACACATCCTAACTCTCCCA
CTGTTTATGACTGGCTTTACAGTGGGGAGACTAGGAGCAAGCATCATCAC
TGAGTGGATGATACGCTCCAGCGATGTAAATGAATGTGATGGGTCACCAA
CTCACCGGATGAGTTGCCTGTAGTCTGTAGATAGTGTCGTTTCGTTTTGG
ATTTCGCAACGTGTCCTTGTCGTTTTGTTAATGCTATTTGTATTACGTGT
CCTTCCTATCTAAAGTTTGGTTTTAAAATGCTGCTGACTAAAAGTAAACT
AAAGACTGTGATGTTTTTATATCATATAATTTAATAATTGTATGTGATGT
GAGGATTGCTAAGCTGTGGGCGGAGATGAAAAGTTGCTGGTTTTTG
back to top