CF832465

Overview
NameCF832465
Unique NameCF832465
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length835
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF832465 vs. ExPASy Swiss-Prot
Match: MYB4_ORYSJ (Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2)

HSP 1 Score: 219.55 bits (558), Expect = 1.791e-56
Identity = 123/277 (44.40%), Postives = 154/277 (55.60%), Query Frame = -2
Query:   67 CEKMGLKKGPWTPEEDQILINYIQLYGHGNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHXXXXXXXXXXQEPVINNHSNAN----HVTARS----------------EICSGAXXXXXXXXXXXXXXXXXXXXSAANNACVKTEPSSSENNHDSLVEIDENFWTEVLSAENSGISIE-DSNDRFSAVGGADPLSIVEFQSSLDAFRPGSTLCDNTDFWFNLFTKAGDFSEM 834
            CEKMGLKKGPWTPEED++L+ +IQ +GHGNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNF++EEEDTII+LHE+LGNRWSAIAARLPGRTDNEIKNVWHTH            P    H  A+    H   +S                   S +                    SA+ + C K E S +  + +   +ID++FW+E LS    G  +  +  D F A   AD +                      D+W  +F ++G+  ++
Sbjct:    7 CEKMGLKKGPWTPEEDKVLVAHIQRHGHGNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEDTIIHLHELLGNRWSAIAARLPGRTDNEIKNVWHTH-----LKKRLDAPAQGGHVAASGGKKHKKPKSAKKPAAAAAAPPASPERSASSSVTESSMASSVAEEHGNAGISSASASVCAKEESSFTSASEE--FQIDDSFWSETLSMPLDGYDVSMEPGDAFVAPPSADDM----------------------DYWLGVFMESGEAQDL 254          
BLAST of CF832465 vs. ExPASy Swiss-Prot
Match: MYB1_MAIZE (Myb-related protein Zm1 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.423e-45
Identity = 82/105 (78.10%), Postives = 91/105 (86.67%), Query Frame = -2
Query:  520 CEKMGLKKGPWTPEEDQILINYIQLYGHGNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHTH 834
            C K+GL +G WTP+ED  LI YIQ +GH NWRALPKQAGLLRCGKSCRLRWINYLRPD+KRGNFT EEE+ II LH +LGN+WS IAA LPGRTDNEIKNVW+TH
Sbjct:    9 CAKVGLNRGSWTPQEDMRLIAYIQKHGHTNWRALPKQAGLLRCGKSCRLRWINYLRPDLKRGNFTDEEEEAIIRLHGLLGNKWSKIAACLPGRTDNEIKNVWNTH 113          
BLAST of CF832465 vs. ExPASy Swiss-Prot
Match: MYBP_MAIZE (Myb-related protein P OS=Zea mays GN=P PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.966e-43
Identity = 77/105 (73.33%), Postives = 89/105 (84.76%), Query Frame = -2
Query:  520 CEKMGLKKGPWTPEEDQILINYIQLYGHGNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHTH 834
            CEK+GLK+G WT EEDQ+L NYI  +G G+WR+LPK AGLLRCGKSCRLRWINYLR D+KRGN ++EEED II LH  LGNRWS IA+ LPGRTDNEIKN W++H
Sbjct:    7 CEKVGLKRGRWTAEEDQLLANYIAEHGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADVKRGNISKEEEDIIIKLHATLGNRWSLIASHLPGRTDNEIKNYWNSH 111          
BLAST of CF832465 vs. ExPASy Swiss-Prot
Match: MYB5_ARATH (Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 5.060e-43
Identity = 79/138 (57.25%), Postives = 100/138 (72.46%), Query Frame = -2
Query:  421 CEKMGLKKGPWTPEEDQILINYIQLYGHGNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHXXXXXXXXXXQEPVINNHSNANHVTARSEICSG 834
            C KMG+K+GPWT EED+IL+++I+  G G WR+LPK+AGLLRCGKSCRLRW+NYLRP +KRG  T +EED I+ LH +LGNRWS IA R+PGRTDNEIKN W+TH           +P  +   +AN++    E  SG
Sbjct:   18 CTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTH-LRKKLLRQGIDPQTHKPLDANNIHKPEEEVSG 154          
BLAST of CF832465 vs. ExPASy Swiss-Prot
Match: MYB30_ANTMA (Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.472e-42
Identity = 77/105 (73.33%), Postives = 86/105 (81.90%), Query Frame = -2
Query:  520 CEKMGLKKGPWTPEEDQILINYIQLYGHGNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHTH 834
            CEK    KG WT EEDQ LINYI+ +G G WR+LPK AGLLRCGKSCRLRWINYLRPD+KRGNFT EE++ II LH +LGN+WS IA  LPGRTDNEIKN W+TH
Sbjct:    7 CEKAHTNKGAWTKEEDQRLINYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTEEEDEIIIKLHSLLGNKWSLIAGALPGRTDNEIKNYWNTH 111          
BLAST of CF832465 vs. ExPASy Swiss-Prot
Match: MYB3_ARATH (Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 5.594e-42
Identity = 73/105 (69.52%), Postives = 88/105 (83.81%), Query Frame = -2
Query:  520 CEKMGLKKGPWTPEEDQILINYIQLYGHGNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHTH 834
            CEK  + KG WT EEDQ+L++YI+ +G G WR+LP+ AGL RCGKSCRLRW+NYLRPD+KRGNFT EE++ II LH +LGN+WS IA RLPGRTDNEIKN W+TH
Sbjct:    7 CEKAHMNKGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTH 111          
BLAST of CF832465 vs. ExPASy Swiss-Prot
Match: MYB12_ARATH (Transcription factor MYB12 OS=Arabidopsis thaliana GN=MYB12 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 5.594e-42
Identity = 75/105 (71.43%), Postives = 86/105 (81.90%), Query Frame = -2
Query:  520 CEKMGLKKGPWTPEEDQILINYIQLYGHGNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHTH 834
            CEK+G+K+G WT EEDQIL NYIQ  G G+WR+LPK AGL RCGKSCRLRWINYLR D+KRGN T EEE+ ++ LH  LGNRWS IA  LPGRTDNEIKN W++H
Sbjct:    7 CEKVGIKRGRWTAEEDQILSNYIQSNGEGSWRSLPKNAGLKRCGKSCRLRWINYLRSDLKRGNITPEEEELVVKLHSTLGNRWSLIAGHLPGRTDNEIKNYWNSH 111          
BLAST of CF832465 vs. ExPASy Swiss-Prot
Match: MYB4_ARATH (Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 7.306e-42
Identity = 75/105 (71.43%), Postives = 86/105 (81.90%), Query Frame = -2
Query:  520 CEKMGLKKGPWTPEEDQILINYIQLYGHGNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHTH 834
            CEK    KG WT EED+ L+ YI+ +G G WR+LPK AGLLRCGKSCRLRWINYLRPD+KRGNFT EE++ II LH +LGN+WS IA RLPGRTDNEIKN W+TH
Sbjct:    7 CEKAHTNKGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTH 111          
BLAST of CF832465 vs. ExPASy Swiss-Prot
Match: MYB38_MAIZE (Myb-related protein Zm38 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 7.306e-42
Identity = 74/105 (70.48%), Postives = 87/105 (82.86%), Query Frame = -2
Query:  520 CEKMGLKKGPWTPEEDQILINYIQLYGHGNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHTH 834
            CEK    +G WT EED+ L+ YI+ +G G WR+LPK AGLLRCGKSCRLRWINYLRPD+KRGNFT +E+D I+ LH +LGN+WS IAARLPGRTDNEIKN W+TH
Sbjct:    7 CEKAHTNRGAWTKEEDERLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTH 111          
BLAST of CF832465 vs. ExPASy Swiss-Prot
Match: MYB6_ARATH (Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.246e-41
Identity = 75/105 (71.43%), Postives = 86/105 (81.90%), Query Frame = -2
Query:  520 CEKMGLKKGPWTPEEDQILINYIQLYGHGNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHTH 834
            CEK    KG WT EEDQ L++YI+ +G G WR+LPK AGLLRCGKSCRLRWINYLRPD+KRGNFT +E+  II LH +LGN+WS IA RLPGRTDNEIKN W+TH
Sbjct:    7 CEKAHTNKGAWTKEEDQRLVDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINYLRPDLKRGNFTDDEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTH 111          
The following BLAST results are available for this feature:
BLAST of CF832465 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
MYB4_ORYSJ1.791e-5644.40Myb-related protein Myb4 OS=Oryza sativa subsp. ja... [more]
MYB1_MAIZE1.423e-4578.10Myb-related protein Zm1 OS=Zea mays PE=2 SV=1[more]
MYBP_MAIZE2.966e-4373.33Myb-related protein P OS=Zea mays GN=P PE=2 SV=1[more]
MYB5_ARATH5.060e-4357.25Transcription repressor MYB5 OS=Arabidopsis thalia... [more]
MYB30_ANTMA1.472e-4273.33Myb-related protein 330 OS=Antirrhinum majus GN=MY... [more]
MYB3_ARATH5.594e-4269.52Transcription factor MYB3 OS=Arabidopsis thaliana ... [more]
MYB12_ARATH5.594e-4271.43Transcription factor MYB12 OS=Arabidopsis thaliana... [more]
MYB4_ARATH7.306e-4271.43Transcription repressor MYB4 OS=Arabidopsis thalia... [more]
MYB38_MAIZE7.306e-4270.48Myb-related protein Zm38 OS=Zea mays PE=2 SV=1[more]
MYB6_ARATH1.246e-4171.43Transcription repressor MYB6 OS=Arabidopsis thalia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01O11_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01O11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832465 ID=CF832465|Name=CF832465|organism=Citrus sinensis|type=EST|length=835bp
TTTTTTTTTTTTTTTTTCCACTAAGAAAGTGAAAATTAGTTACTTTAATC
ATAAAATTTCTGGTAACATTTCTGAGAAATCTCCAGCTTTGGTGAAAAGA
TTGAACCAAAAGTCGGTGTTATCACACAAAGTAGAACCAGGTCTAAAAGC
ATCGAGTGATGATTGAAATTCAACTATAGACAGTGGGTCGGCGCCTCCAA
CCGCTGAAAAACGATCATTGCTGTCCTCAATACTAATGCCCGAGTTCTCA
GCCGACAACACTTCCGTCCAAAAATTCTCATCTATTTCAACCAAGCTGTC
GTGATTGTTTTCGGACGACGACGGCTCTGTTTTCACGCAAGCGTTATTAG
CCGCGGAGGAGGTGACGGACGACATGTCGCTTGAAGTAGTAGTCGAGTCT
TGCCGATCGGGAGTACTGGCGCCGCTGCAAATCTCGGATCTCGCCGTAAC
ATGATTAGCGTTACTATGATTATTAATCACGGGCTCTTGTTGTTGCTTTT
GCTTGAGACGCTTTTTCAAGTGAGTGTGCCAAACATTTTTAATTTCGTTG
TCCGTTCTTCCCGGAAGTCTTGCTGCGATTGCTGACCATCTATTTCCGAG
CATTTCATGTAGGTTGATGATAGTGTCCTCTTCTTCTCTGGTGAAATTTC
CCCGTTTAATATCCGGCCGCAAGTAATTTATCCACCGGAGCCGGCAACTC
TTTCCACATCTTAATAAACCTGCTTGTTTGGGAAGTGCCCGCCAGTTGCC
ATGGCCATAAAGTTGAATGTAATTGATTAAAATTTGATCTTCTTCAGGAG
TCCATGGACCTTTCTTCAATCCCATCTTCTCGCAG
back to top