CF832523

Overview
NameCF832523
Unique NameCF832523
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length845
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF832523 vs. ExPASy Swiss-Prot
Match: NEP1_NEPGR (Aspartic proteinase nepenthesin-1 OS=Nepenthes gracilis GN=nep1 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.315e-16
Identity = 77/249 (30.92%), Postives = 112/249 (44.98%), Query Frame = -2
Query:  149 MPKIIFGCGHNNSESPNTRSNRXXXXXXXXXXXXXXSQMATSIAGKFSYCLPHQGSST---INFGGIVAG--AGVVSTPLI----IRDHYYLTLEAISVGNQRLEFVSGGKYFIDAGN----IFVDTGVQRTLLPLEYDSNLKLVMSNMIRAQPIEIKIGEPGLSDILCYNISSQP---ELPEVTIHFKGADVKLSPSNIFQNFSDDLMCSAFRGGDAN-TIYGNIMQINFLIGYDTEQRTVSFKSTHC 844
            +P I FGCG NN      + N               SQ+  +   KFSYC+   GSST   +  G +     AG  +T LI    I   YY+TL  +SVG+ RL  +    + +++ N    I +D+G   T L    ++  + V    I    + +  G     D LC+   S P   ++P   +HF G D++L   N F + S+ L+C A        +I+GNI Q N L+ YDT    VSF S  C
Sbjct:  196 IPNITFGCGENNQGFG--QGNGAGLVGMGRGPLSLPSQLDVT---KFSYCMTPIGSSTPSNLLLGSLANSVTAGSPNTTLIQSSQIPTFYYITLNGLSVGSTRLP-IDPSAFALNSNNGTGGIIIDSG---TTLTYFVNNAYQSVRQEFISQINLPVVNGSSSGFD-LCFQTPSDPSNLQIPTFVMHFDGGDLELPSENYFISPSNGLICLAMGSSSQGMSIFGNIQQQNMLVVYDTGNSVVSFASAQC 434          
BLAST of CF832523 vs. ExPASy Swiss-Prot
Match: NEP2_NEPGR (Aspartic proteinase nepenthesin-2 OS=Nepenthes gracilis GN=nep2 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 7.183e-13
Identity = 69/248 (27.82%), Postives = 108/248 (43.55%), Query Frame = -2
Query:  149 MPKIIFGCGHNNSESPNTRSNRXXXXXXXXXXXXXXSQMATSIAGKFSYCLPHQGSS---TINFGGIVAGA--GVVSTPLIIRD----HYYLTLEAISVGNQRLEFVSGGKYFID--AGNIFVDTGVQRTLLPLEYDSNLKLVMSNMIRAQPIEIKIGEPGLSDILCY---NISSQPELPEVTIHFKGADVKLSPSNIFQNFSDDLMCSAFRGGD--ANTIYGNIMQINFLIGYDTEQRTVSFKSTHC 844
            +P I FGCG +N      + N               SQ+     G+FSYC+   GSS   T+  G   +G   G  ST LI       +YY+TL+ I+VG   L   S      D   G + +D+G   T LP +  + +    ++ I    ++      GLS   C+   +  S  ++PE+++ F G  + L   NI  + ++ ++C A         +I+GNI Q    + YD +   VSF  T C
Sbjct:  197 VPNIAFGCGEDNQGFG--QGNGAGLIGMGWGPLSLPSQLGV---GQFSYCMTSYGSSSPSTLALGSAASGVPEGSPSTTLIHSSLNPTYYYITLQGITVGGDNLGIPSSTFQLQDDGTGGMIIDSGTTLTYLPQDAYNAVAQAFTDQINLPTVDES--SSGLST--CFQQPSDGSTVQVPEISMQFDGGVLNLGEQNILISPAEGVICLAMGSSSQLGISIFGNIQQQETQVLYDLQNLAVSFVPTQC 435          
The following BLAST results are available for this feature:
BLAST of CF832523 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
NEP1_NEPGR5.315e-1630.92Aspartic proteinase nepenthesin-1 OS=Nepenthes gra... [more]
NEP2_NEPGR7.183e-1327.82Aspartic proteinase nepenthesin-2 OS=Nepenthes gra... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01P21_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01P21, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832523 ID=CF832523|Name=CF832523|organism=Citrus sinensis|type=EST|length=845bp
TTTTTTTTTTTTTTTTAGGACGAGAAAGCTTTAGATATAAGACTTCCAAT
CAAATAGAACAACATCAATTAAAATAAAGAAAAAACAGTTTAAACATTAA
CCAAAAGCACACTTCCCAAGCTTTCCAGTTACTTAATTAATTGTTGGCGC
AATGAGTCGACTTAAACGACACTGTCCTTTGCTCAGTGTCATAGCCGATT
AAGAAGTTTATCTGCATTATGTTCCCGTAAATTGTATTGGCATCACCACC
TCTAAAAGCAGAACACATGAGATCATCTGAAAAATTCTGAAAAATGTTGG
AAGGGCTCAATTTCACATCTGCGCCTTTAAAATGAATTGTTACTTCAGGA
AGCTCAGGCTGTGAACTAATATTATAACAGAGAATATCAGATAGGCCAGG
CTCACCTATTTTGATTTCAATGGGTTGTGCCCTTATCATGTTGGACATTA
CTAACTTCAAATTTGAGTCATACTCTAGTGGTAATAAAGTACGTTGAACA
CCAGTATCAACAAAAATGTTTCCAGCATCAATAAAATATTTTCCACCGGA
CACAAATTCTAGCCTTTGGTTGCCTACACTGATTGCTTCAAGGGTGAGAT
AATAATGGTCCCTAATAATCAAAGGGGTAGAAACTACCCCGGCACCCGCA
ACAATTCCACCAAAGTTTATTGTGCTTGAACCTTGATGGGGCAGGCAATA
GGAGAATTTACCAGCAATTGATGTTGCCATTTGAGAAATTAATGAAGAAC
TGCCGGGTCCAAGGCCAATGGTGCCGGTTCGATTTGAACGAGTGTTTGGG
CTTTCACTGTTGTTGTGTCCGCAACCAAAGATTATTTTTGGCATT
back to top