CF832531

Overview
NameCF832531
Unique NameCF832531
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length652
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13761 contig Csv1_Contig13761:27..677. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832531 vs. ExPASy Swiss-Prot
Match: RS263_ARATH (40S ribosomal protein S26-3 OS=Arabidopsis thaliana GN=RPS26C PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 9.323e-30
Identity = 63/82 (76.83%), Postives = 66/82 (80.49%), Query Frame = -1
Query:  371 MTFXXXXXXXXXXXXXHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 616
            MTF             HVK IRCSNCGKCCPKDKAIKRF+VRNIVEQAA+RDVQEA VY+GYTLPKLYAK QYCVSCAIHSH
Sbjct:    1 MTFKRRNGGRNKHNRGHVKPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSH 82          
BLAST of CF832531 vs. ExPASy Swiss-Prot
Match: RS262_ARATH (40S ribosomal protein S26-2 OS=Arabidopsis thaliana GN=RPS26B PE=2 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 3.543e-29
Identity = 62/82 (75.61%), Postives = 65/82 (79.27%), Query Frame = -1
Query:  371 MTFXXXXXXXXXXXXXHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 616
            MTF             HV  IRCSNCGKCCPKDKAIKRF+VRNIVEQAA+RDVQEA VY+GYTLPKLYAK QYCVSCAIHSH
Sbjct:    1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSH 82          
BLAST of CF832531 vs. ExPASy Swiss-Prot
Match: RS261_ARATH (40S ribosomal protein S26-1 OS=Arabidopsis thaliana GN=RPS26A PE=2 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 3.543e-29
Identity = 62/82 (75.61%), Postives = 65/82 (79.27%), Query Frame = -1
Query:  371 MTFXXXXXXXXXXXXXHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 616
            MTF             HV  IRCSNCGKCCPKDKAIKRF+VRNIVEQAA+RDVQEA VY+GYTLPKLYAK QYCVSCAIHSH
Sbjct:    1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSH 82          
BLAST of CF832531 vs. ExPASy Swiss-Prot
Match: RS26_ORYSJ (40S ribosomal protein S26 OS=Oryza sativa subsp. japonica GN=RPS26 PE=2 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 1.346e-28
Identity = 59/82 (71.95%), Postives = 65/82 (79.27%), Query Frame = -1
Query:  371 MTFXXXXXXXXXXXXXHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 616
            MTF             HVK+IRCSNC KCCPKDKAIKRF VRNIVEQAA+RDVQEACV+DGY LPKLYAK+ +CVSCAIH+H
Sbjct:    1 MTFKRRNGGRNKHGRGHVKYIRCSNCAKCCPKDKAIKRFQVRNIVEQAAIRDVQEACVHDGYVLPKLYAKVHHCVSCAIHAH 82          
BLAST of CF832531 vs. ExPASy Swiss-Prot
Match: RS26_OCTVU (40S ribosomal protein S26 OS=Octopus vulgaris GN=RPS26 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.442e-22
Identity = 46/64 (71.88%), Postives = 56/64 (87.50%), Query Frame = -1
Query:  374 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 565
            VK+IRC+NC +C PKDKAIK+F++RNIVE AAVRD+ +A VY+ Y LPKLYAK+ YCVSCAIHS
Sbjct:   18 VKYIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISDASVYEVYALPKLYAKLLYCVSCAIHS 81          
BLAST of CF832531 vs. ExPASy Swiss-Prot
Match: RS26_CAEEL (40S ribosomal protein S26 OS=Caenorhabditis elegans GN=rps-26 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.442e-22
Identity = 49/81 (60.49%), Postives = 58/81 (71.60%), Query Frame = -1
Query:  374 MTFXXXXXXXXXXXXXHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 616
            MTF             HV FIRC+NCG+CCPKDKAIK+F+VRNIVE AAVRD+ +A  Y  Y LPKLY K+ YC++CAIHS
Sbjct:    1 MTFKRRNHGRNKKNRGHVAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYTQYALPKLYHKLHYCIACAIHS 81          
BLAST of CF832531 vs. ExPASy Swiss-Prot
Match: RS26_DROME (40S ribosomal protein S26 OS=Drosophila melanogaster GN=RpS26 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.212e-22
Identity = 45/64 (70.31%), Postives = 55/64 (85.94%), Query Frame = -1
Query:  374 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 565
            VK +RC+NC +C PKDKAIK+F++RNIVE AAVRD+ EA ++D Y LPKLYAK+ YCVSCAIHS
Sbjct:   18 VKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLPKLYAKLHYCVSCAIHS 81          
BLAST of CF832531 vs. ExPASy Swiss-Prot
Match: RS26_ANOGA (40S ribosomal protein S26 OS=Anopheles gambiae GN=RpS26 PE=3 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 3.212e-22
Identity = 45/64 (70.31%), Postives = 54/64 (84.38%), Query Frame = -1
Query:  374 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 565
            VK +RC+NC +C PKDKAIK+F++RNIVE AAVRD+ +A VY  Y LPKLYAK+ YCVSCAIHS
Sbjct:   18 VKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISDASVYSSYVLPKLYAKLHYCVSCAIHS 81          
BLAST of CF832531 vs. ExPASy Swiss-Prot
Match: RS26_RAT (40S ribosomal protein S26 OS=Rattus norvegicus GN=Rps26 PE=3 SV=3)

HSP 1 Score: 103.605 bits (257), Expect = 9.345e-22
Identity = 45/64 (70.31%), Postives = 54/64 (84.38%), Query Frame = -1
Query:  374 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 565
            V+ IRC+NC +C PKDKAIK+F++RNIVE AAVRD+ EA V+D Y LPKLY K+ YCVSCAIHS
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHS 81          
BLAST of CF832531 vs. ExPASy Swiss-Prot
Match: RS26_PIG (40S ribosomal protein S26 OS=Sus scrofa GN=RPS26 PE=3 SV=4)

HSP 1 Score: 103.605 bits (257), Expect = 9.345e-22
Identity = 45/64 (70.31%), Postives = 54/64 (84.38%), Query Frame = -1
Query:  374 VKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 565
            V+ IRC+NC +C PKDKAIK+F++RNIVE AAVRD+ EA V+D Y LPKLY K+ YCVSCAIHS
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHS 81          
The following BLAST results are available for this feature:
BLAST of CF832531 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
RS263_ARATH9.323e-3076.8340S ribosomal protein S26-3 OS=Arabidopsis thalian... [more]
RS262_ARATH3.543e-2975.6140S ribosomal protein S26-2 OS=Arabidopsis thalian... [more]
RS261_ARATH3.543e-2975.6140S ribosomal protein S26-1 OS=Arabidopsis thalian... [more]
RS26_ORYSJ1.346e-2871.9540S ribosomal protein S26 OS=Oryza sativa subsp. j... [more]
RS26_OCTVU1.442e-2271.8840S ribosomal protein S26 OS=Octopus vulgaris GN=R... [more]
RS26_CAEEL1.442e-2260.4940S ribosomal protein S26 OS=Caenorhabditis elegan... [more]
RS26_DROME3.212e-2270.3140S ribosomal protein S26 OS=Drosophila melanogast... [more]
RS26_ANOGA3.212e-2270.3140S ribosomal protein S26 OS=Anopheles gambiae GN=... [more]
RS26_RAT9.345e-2270.3140S ribosomal protein S26 OS=Rattus norvegicus GN=... [more]
RS26_PIG9.345e-2270.3140S ribosomal protein S26 OS=Sus scrofa GN=RPS26 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_02A04_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa02A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832531 ID=CF832531|Name=CF832531|organism=Citrus sinensis|type=EST|length=652bp
TTTTTTTTTTTTTTTTTACTTCAATCACTCCATCAAAATTCTCTACGGTT
TTGATTCAAACTTGTGACAGTAAACAGTTCTCTGATGCACGACAACAAAA
CACAAAACTAACATAAAAGTTTGCAGTGCTCTAATTAAACAGACCCACAT
ATCTGATACCACCACATAAAAATCTCAAAAGCCTCAAAGGACCAGAAGCA
CCGACAGCAGAAAGCTTTCAAGCACGAGCAGCAGCTGGAGCTCCAGCTGG
ACCACCAGCACGTGGGCCTTGACCAAGAGCACCACCAGCCTTTGGCACAT
CATCCCTGCGCCTGAAGCGTTGTGGGGGCTCACGGATCCTCCTGTTAGTA
CGGGAACGAACTCTCACCACATGAGAGTGGATCGCACACGAGACGCAGTA
CTGCATCTTAGCATATAACTTAGGAAGAGTGTAACCGTCATAAACACACG
CCTCCTGAACATCCCTAACAGCAGCTTGCTCAACAATGTTCCTCACCAAA
AACCTCTTAATCGCCTTGTCCTTAGGGCAGCATTTGCCGCAGTTAGAGCA
GCGGATGAACTTGACATGGCCACGGCCGTGCTTGTTCCTTCCTCCGTTCC
TCCGCTTGAACGTCATTTTCTTGTTATTTTTGTTGCGCCGCTGCTGCTTG
TT
back to top