CF832532

Overview
NameCF832532
Unique NameCF832532
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length652
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13761 contig Csv1_Contig13761:26..676. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832532 vs. ExPASy Swiss-Prot
Match: RS263_ARATH (40S ribosomal protein S26-3 OS=Arabidopsis thaliana GN=RPS26C PE=2 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.695e-39
Identity = 74/82 (90.24%), Postives = 77/82 (93.90%), Query Frame = 2
Query:   38 MTFKRSNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 283
            MTFKR NGGRNKH RGHVK IRCSNCGKCCPKDKAIKRF+VRNIVEQAA+RDVQEA VY+GYTLPKLYAK QYCVSCAIHSH
Sbjct:    1 MTFKRRNGGRNKHNRGHVKPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSH 82          
BLAST of CF832532 vs. ExPASy Swiss-Prot
Match: RS26_ORYSJ (40S ribosomal protein S26 OS=Oryza sativa subsp. japonica GN=RPS26 PE=2 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 4.932e-39
Identity = 71/82 (86.59%), Postives = 77/82 (93.90%), Query Frame = 2
Query:   38 MTFKRSNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 283
            MTFKR NGGRNKHGRGHVK+IRCSNC KCCPKDKAIKRF VRNIVEQAA+RDVQEACV+DGY LPKLYAK+ +CVSCAIH+H
Sbjct:    1 MTFKRRNGGRNKHGRGHVKYIRCSNCAKCCPKDKAIKRFQVRNIVEQAAIRDVQEACVHDGYVLPKLYAKVHHCVSCAIHAH 82          
BLAST of CF832532 vs. ExPASy Swiss-Prot
Match: RS262_ARATH (40S ribosomal protein S26-2 OS=Arabidopsis thaliana GN=RPS26B PE=2 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 6.442e-39
Identity = 73/82 (89.02%), Postives = 76/82 (92.68%), Query Frame = 2
Query:   38 MTFKRSNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 283
            MTFKR NGGRNKH RGHV  IRCSNCGKCCPKDKAIKRF+VRNIVEQAA+RDVQEA VY+GYTLPKLYAK QYCVSCAIHSH
Sbjct:    1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSH 82          
BLAST of CF832532 vs. ExPASy Swiss-Prot
Match: RS261_ARATH (40S ribosomal protein S26-1 OS=Arabidopsis thaliana GN=RPS26A PE=2 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 6.442e-39
Identity = 73/82 (89.02%), Postives = 76/82 (92.68%), Query Frame = 2
Query:   38 MTFKRSNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 283
            MTFKR NGGRNKH RGHV  IRCSNCGKCCPKDKAIKRF+VRNIVEQAA+RDVQEA VY+GYTLPKLYAK QYCVSCAIHSH
Sbjct:    1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSH 82          
BLAST of CF832532 vs. ExPASy Swiss-Prot
Match: RS26_DROME (40S ribosomal protein S26 OS=Drosophila melanogaster GN=RpS26 PE=1 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 3.785e-31
Identity = 59/81 (72.84%), Postives = 69/81 (85.19%), Query Frame = 2
Query:   38 MTFKRSNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 280
            MT KR NGGRNKH RGHVK +RC+NC +C PKDKAIK+F++RNIVE AAVRD+ EA ++D Y LPKLYAK+ YCVSCAIHS
Sbjct:    1 MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLPKLYAKLHYCVSCAIHS 81          
BLAST of CF832532 vs. ExPASy Swiss-Prot
Match: RS26_CAEEL (40S ribosomal protein S26 OS=Caenorhabditis elegans GN=rps-26 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.453e-30
Identity = 58/81 (71.60%), Postives = 67/81 (82.72%), Query Frame = 2
Query:   38 MTFKRSNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 280
            MTFKR N GRNK  RGHV FIRC+NCG+CCPKDKAIK+F+VRNIVE AAVRD+ +A  Y  Y LPKLY K+ YC++CAIHS
Sbjct:    1 MTFKRRNHGRNKKNRGHVAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYTQYALPKLYHKLHYCIACAIHS 81          
BLAST of CF832532 vs. ExPASy Swiss-Prot
Match: RS26_ANOGA (40S ribosomal protein S26 OS=Anopheles gambiae GN=RpS26 PE=3 SV=2)

HSP 1 Score: 131.339 bits (329), Expect = 4.185e-30
Identity = 58/81 (71.60%), Postives = 67/81 (82.72%), Query Frame = 2
Query:   38 MTFKRSNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 280
            MT KR NGGR KH RGHVK +RC+NC +C PKDKAIK+F++RNIVE AAVRD+ +A VY  Y LPKLYAK+ YCVSCAIHS
Sbjct:    1 MTKKRRNGGRCKHNRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISDASVYSSYVLPKLYAKLHYCVSCAIHS 81          
BLAST of CF832532 vs. ExPASy Swiss-Prot
Match: RS26B_SCHPO (40S ribosomal protein S26-B OS=Schizosaccharomyces pombe GN=rps26b PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 5.466e-30
Identity = 58/81 (71.60%), Postives = 67/81 (82.72%), Query Frame = 2
Query:   38 MTFKRSNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 280
            MT KR N GRNKHGRGHVKF+RC NC +  PKDKAIKR+ +RN+VE AA+RD+ EA VY  YT+PKLY K+QYCVSCAIHS
Sbjct:    1 MTQKRRNNGRNKHGRGHVKFVRCINCSRAVPKDKAIKRWTIRNMVETAAIRDLSEASVYSEYTIPKLYIKLQYCVSCAIHS 81          
BLAST of CF832532 vs. ExPASy Swiss-Prot
Match: RS26_SCHCO (40S ribosomal protein S26 OS=Schizophyllum commune GN=RPS26 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 7.138e-30
Identity = 58/82 (70.73%), Postives = 66/82 (80.49%), Query Frame = 2
Query:   38 MTFKRSNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 283
            MT KR NGGRNK GRGHV F+RCSNC +C  KDKAIKRF VRN+VE AA+RD+ +A VY  Y +PKLY K+ YCVSCAIHSH
Sbjct:    1 MTKKRRNGGRNKSGRGHVTFVRCSNCSRCVAKDKAIKRFTVRNMVESAAIRDISDASVYPEYAIPKLYIKIAYCVSCAIHSH 82          
BLAST of CF832532 vs. ExPASy Swiss-Prot
Match: RS26_OCTVU (40S ribosomal protein S26 OS=Octopus vulgaris GN=RPS26 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 7.138e-30
Identity = 58/81 (71.60%), Postives = 68/81 (83.95%), Query Frame = 2
Query:   38 MTFKRSNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 280
            MT KR N GR K GRGHVK+IRC+NC +C PKDKAIK+F++RNIVE AAVRD+ +A VY+ Y LPKLYAK+ YCVSCAIHS
Sbjct:    1 MTSKRRNNGRGKKGRGHVKYIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISDASVYEVYALPKLYAKLLYCVSCAIHS 81          
The following BLAST results are available for this feature:
BLAST of CF832532 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
RS263_ARATH1.695e-3990.2440S ribosomal protein S26-3 OS=Arabidopsis thalian... [more]
RS26_ORYSJ4.932e-3986.5940S ribosomal protein S26 OS=Oryza sativa subsp. j... [more]
RS262_ARATH6.442e-3989.0240S ribosomal protein S26-2 OS=Arabidopsis thalian... [more]
RS261_ARATH6.442e-3989.0240S ribosomal protein S26-1 OS=Arabidopsis thalian... [more]
RS26_DROME3.785e-3172.8440S ribosomal protein S26 OS=Drosophila melanogast... [more]
RS26_CAEEL2.453e-3071.6040S ribosomal protein S26 OS=Caenorhabditis elegan... [more]
RS26_ANOGA4.185e-3071.6040S ribosomal protein S26 OS=Anopheles gambiae GN=... [more]
RS26B_SCHPO5.466e-3071.6040S ribosomal protein S26-B OS=Schizosaccharomyces... [more]
RS26_SCHCO7.138e-3070.7340S ribosomal protein S26 OS=Schizophyllum commune... [more]
RS26_OCTVU7.138e-3071.6040S ribosomal protein S26 OS=Octopus vulgaris GN=R... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_02A04_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa02A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832532 ID=CF832532|Name=CF832532|organism=Citrus sinensis|type=EST|length=652bp
CAACAAGCAGCCCCTGCGCAACAAAAATAACAAGAAAATGACGTTCAAGC
GGAGCAACGGAGGAAGGAACAAGCACGGCCGTGGCCATGTCAAGTTCATC
CGCTGCTCTAACTGCGGCAAATGCTGCCCTAAGGACAAGGCGATTAAGAG
GTTTTTGGTGAGGAACATTGTTGAGCAAGCTGCTGTTAGGGATGTTCAGG
AGGCGTGTGTTTATGACGGTTACACTCTTCCTAAGTTATATGCTAAGATG
CAGTACTGCGTCTCGTGTGCGATCCACTCTCATGTGGTGAGAGTTCGTTC
CCGTACTAACAGGAGGATCCGTGAGCCCCCACAACGCTTCAGGCGCAGGG
ATGATGTGCCAAAGGCTGGTGGTGCTCTTGGTCAAGGCCCACGTGCTGGT
GGTCCAGCTGGAGCTCCAGCTGCTGCTCGTGCTTGAAAGCTTTCTGCTGT
CGGTGCTTCTGGTCCTTTGAGGCTTTTGAGATTTTTATGTGGTGGTATCA
GATATGTGGGTCTGTTTAATTAGAGCACTGCAAACTTTTATGTTAGTTTT
GTGTTTTGTTGTCGTGCATCAGAGAACTGTTTACTGTCACAAGTTTGAAT
CAAAACCCTAGAGAATTTTGATGGAGTGATTGAAGTAAAAAAAAAAAAAA
AA
back to top