CF832534

Overview
NameCF832534
Unique NameCF832534
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length679
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7134 contig Csv1_Contig7134:252..930. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832534 vs. ExPASy Swiss-Prot
Match: MYBG_DICDI (Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.461e-28
Identity = 81/226 (35.84%), Postives = 109/226 (48.23%), Query Frame = 2
Query:    2 AAGTFKVRKPYTITKSRACWTDEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIRSHAQKYFLKVQKNGTIAHVXXXXXXXXXXXXXXQKASKNVLPPLQAAMAYPSVNALAHGFAAWDDASMLVNAEKMMPS-QDKYTNLHAIEADDXXXXXXXXXXXXTVGGIGSSTRTQPSTDMPKQGNQVPVLHGIPDFAEVYSFIGSVFDPDTKGHVQKLKEMDPINFETV 676
            AA + K RKPYTI+K R  WTDEEH KFLEAL LFDRDWKKIE FVGSKTVIQIRSHAQKYF+KVQKN T   +              QK   + +          +    +  FA W      +    +MP+  +   N   ++                V    SS R       P   N    L   P+F ++Y+F+ ++F+ +     + L ++  I+ ET+
Sbjct:   25 AANSLKSRKPYTISKQRENWTDEEHQKFLEALTLFDRDWKKIESFVGSKTVIQIRSHAQKYFIKVQKNNTGERIPPPRPKRKSIQPYPQKQKHDGMGAFIPDSLSGNHFISSSSFATW------MTYRGLMPNISESQINPSDLQKQLEQLQQAQQYIQQAVTTAQSSQRNGGLPPNPSSNNGGTTL--TPNFPKIYAFLSNLFESNGTSFTEALSDLSMIDRETM 242          
BLAST of CF832534 vs. ExPASy Swiss-Prot
Match: LHY_ARATH (Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 1.768e-18
Identity = 38/66 (57.58%), Postives = 54/66 (81.82%), Query Frame = 2
Query:   17 KVRKPYTITKSRACWTDEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIRSHAQKYFLKVQKNGTI 214
            K RKPYTITK R  WT++EH++FLEAL+L+ R W++IE+ +G+KT +QIRSHAQK+F K++K   +
Sbjct:   13 KARKPYTITKQRERWTEDEHERFLEALRLYGRAWQRIEEHIGTKTAVQIRSHAQKFFTKLEKEAEV 78          
BLAST of CF832534 vs. ExPASy Swiss-Prot
Match: CCA1_ARATH (Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.015e-18
Identity = 40/62 (64.52%), Postives = 52/62 (83.87%), Query Frame = 2
Query:   17 KVRKPYTITKSRACWTDEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIRSHAQKYFLKVQK 202
            K RKPYTITK R  WT+EEH++F+EAL+L+ R W+KIE+ V +KT +QIRSHAQK+F KV+K
Sbjct:   13 KTRKPYTITKQRERWTEEEHNRFIEALRLYGRAWQKIEEHVATKTAVQIRSHAQKFFSKVEK 74          
BLAST of CF832534 vs. ExPASy Swiss-Prot
Match: MYBH_DICDI (Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.090e-11
Identity = 29/54 (53.70%), Postives = 44/54 (81.48%), Query Frame = 2
Query:   47 SRACWTDEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIRSHAQKYFLKVQKNG 208
            +R+ WT EE   F+EA +L+D+D KKI++ V +KT++Q+RSHAQK+ LK++KNG
Sbjct:  149 TRSSWTKEEERLFVEAYKLYDKDNKKIQEHVKTKTILQVRSHAQKFALKLEKNG 202          
The following BLAST results are available for this feature:
BLAST of CF832534 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
MYBG_DICDI2.461e-2835.84Myb-like protein G OS=Dictyostelium discoideum GN=... [more]
LHY_ARATH1.768e-1857.58Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV... [more]
CCA1_ARATH3.015e-1864.52Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 ... [more]
MYBH_DICDI6.090e-1153.70Myb-like protein H OS=Dictyostelium discoideum GN=... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_02A05_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa02A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832534 ID=CF832534|Name=CF832534|organism=Citrus sinensis|type=EST|length=679bp
CGCAGCTGGGACCTTTAAGGTACGGAAACCCTACACCATCACCAAATCTA
GAGCATGCTGGACTGACGAAGAACACGACAAGTTCCTTGAAGCTCTTCAG
CTGTTTGACCGTGACTGGAAAAAAATTGAAGATTTTGTCGGTTCAAAGAC
AGTCATTCAGATTCGGAGTCATGCTCAGAAATACTTTTTGAAGGTTCAAA
AGAATGGGACAATTGCACATGTTCCTCCTCCTCGTCCCAAGCGGAAAGCT
GCTCATCCTTACCCACAAAAGGCCTCGAAAAATGTTCTACCGCCCCTTCA
AGCAGCCATGGCTTATCCATCAGTAAATGCCCTTGCACATGGATTTGCTG
CTTGGGATGATGCTTCCATGCTGGTAAATGCTGAAAAAATGATGCCATCG
CAGGATAAATATACCAATCTTCACGCAATCGAAGCTGATGATATTGGATC
AAAGGGGATATCGGGAATAGGTAATAGTACTGTTGGTGGCATTGGAAGCT
CAACTAGAACACAACCTAGTACAGACATGCCAAAACAGGGGAATCAAGTT
CCCGTTCTTCACGGTATTCCAGACTTCGCTGAAGTGTATAGCTTCATAGG
GAGTGTTTTTGATCCAGACACCAAAGGCCATGTACAAAAGCTCAAAGAAA
TGGATCCCATAAATTTTGAAACAGTATTG
back to top