CF832535

Overview
NameCF832535
Unique NameCF832535
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length651
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2930 contig Csv1_Contig2930:415..1065. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRFC_ARATH (Ribosome-recycling factor, chloroplastic OS=Arabidopsis thaliana GN=RRF PE=1 SV=2)

HSP 1 Score: 247.669 bits (631), Expect = 3.969e-65
Identity = 125/146 (85.62%), Postives = 140/146 (95.89%), Query Frame = -2
Query:  213 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 650
            SN AMLDKIEVEYYGSPVSLKSIAQI+TPD SSLL+QPYDKSSLK+IEKAIV+SDLG+TPNNDG+VIRL+LP LTS+RRKELSKVVAKQ+EEGKVA+RNIRRDALK+Y+KL+KEKKLSEDNVKDLSSDLQKL D YMKKI+ +YKQ
Sbjct:  122 SNAAMLDKIEVEYYGSPVSLKSIAQISTPDGSSLLLQPYDKSSLKAIEKAIVNSDLGVTPNNDGDVIRLSLPPLTSDRRKELSKVVAKQSEEGKVALRNIRRDALKSYDKLEKEKKLSEDNVKDLSSDLQKLIDVYMKKIEELYKQ 267          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRFC_DAUCA (Ribosome-recycling factor, chloroplastic (Fragment) OS=Daucus carota GN=RRF PE=2 SV=2)

HSP 1 Score: 246.128 bits (627), Expect = 1.155e-64
Identity = 120/146 (82.19%), Postives = 141/146 (96.58%), Query Frame = -2
Query:  213 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 650
            SNP MLDKI+VEYYG+P SLKSIAQI+TPDSSSLL+ PYDKSSLK IEKAIV+SDLG+TPNNDG+VIRL++PQLT++RRKELSK+VAKQAEEGKVA+RNIRRDA+K+Y+KL+KEKKLSEDNVKDLSSDLQK+ DEY+KK+DSI+KQ
Sbjct:   74 SNPDMLDKIKVEYYGTPTSLKSIAQISTPDSSSLLVNPYDKSSLKDIEKAIVNSDLGITPNNDGDVIRLSIPQLTADRRKELSKIVAKQAEEGKVALRNIRRDAIKSYDKLEKEKKLSEDNVKDLSSDLQKVIDEYIKKVDSIFKQ 219          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRFC_SPIOL (Ribosome-recycling factor, chloroplastic OS=Spinacia oleracea GN=RRF PE=1 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 3.360e-64
Identity = 122/146 (83.56%), Postives = 141/146 (96.58%), Query Frame = -2
Query:  213 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 650
            ++P MLD+IEVEYYG+PVSLKSIAQI+TPD+SSLLI PYDKSSLK+IEKAIV+S LG++PNNDGEVIRL+LP LTS+RRKEL+KVV+K AEEGKVAVRNIRRDALK+YEKL+KEKKLSEDNVKDLS+DLQKLTDEYMKK++SIYKQ
Sbjct:  118 ASPTMLDRIEVEYYGTPVSLKSIAQISTPDASSLLISPYDKSSLKAIEKAIVTSQLGVSPNNDGEVIRLSLPPLTSDRRKELAKVVSKLAEEGKVAVRNIRRDALKSYEKLEKEKKLSEDNVKDLSADLQKLTDEYMKKVESIYKQ 263          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRFC_ORYSJ (Ribosome-recycling factor, chloroplastic OS=Oryza sativa subsp. japonica GN=Os07g0570700 PE=2 SV=2)

HSP 1 Score: 238.424 bits (607), Expect = 2.408e-62
Identity = 117/146 (80.14%), Postives = 140/146 (95.89%), Query Frame = -2
Query:  213 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 650
            +NPAMLD+IEVEYYG+PV+LKSIAQINTPD++SLLIQPYDKSSLK IEK IV+++LG+TP+NDGEVIR+T+P LTS+RRKEL+K VAK AEEGKVA+RNIRRDA+KAY+KL+KEKKLSEDNVKDLS+DLQK+TDEYMKKI++I KQ
Sbjct:  113 ANPAMLDRIEVEYYGTPVNLKSIAQINTPDATSLLIQPYDKSSLKLIEKTIVAANLGVTPSNDGEVIRVTVPPLTSDRRKELAKTVAKLAEEGKVAIRNIRRDAIKAYDKLEKEKKLSEDNVKDLSADLQKVTDEYMKKIEAIQKQ 258          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRFC_ORYSI (Ribosome-recycling factor, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_26546 PE=1 SV=2)

HSP 1 Score: 238.424 bits (607), Expect = 2.408e-62
Identity = 117/146 (80.14%), Postives = 140/146 (95.89%), Query Frame = -2
Query:  213 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 650
            +NPAMLD+IEVEYYG+PV+LKSIAQINTPD++SLLIQPYDKSSLK IEK IV+++LG+TP+NDGEVIR+T+P LTS+RRKEL+K VAK AEEGKVA+RNIRRDA+KAY+KL+KEKKLSEDNVKDLS+DLQK+TDEYMKKI++I KQ
Sbjct:  113 ANPAMLDRIEVEYYGTPVNLKSIAQINTPDATSLLIQPYDKSSLKLIEKTIVAANLGVTPSNDGEVIRVTVPPLTSDRRKELAKTVAKLAEEGKVAIRNIRRDAIKAYDKLEKEKKLSEDNVKDLSADLQKVTDEYMKKIEAIQKQ 258          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_SYNJB (Ribosome-recycling factor OS=Synechococcus sp. GN=frr PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.419e-46
Identity = 88/143 (61.54%), Postives = 117/143 (81.82%), Query Frame = -2
Query:  222 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSI 650
            +N ++LD+I+VEYYG P  LK++A + TPDSS+LLIQP+D S+L +IE+AIV+SDLG+TP+NDG+V+RLT+P LT ERRKELSK VAK AEEG+V++RNIRRD + +  K +K  +LSED  K L  D+QKLTD Y+KKID +
Sbjct:   29 ANSSLLDRIQVEYYGVPTPLKALASLTTPDSSTLLIQPFDPSTLAAIERAIVASDLGLTPSNDGKVVRLTIPPLTEERRKELSKQVAKLAEEGRVSIRNIRRDGIDSVRKREKNGELSEDESKSLQDDIQKLTDRYIKKIDEL 171          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_ANASP (Ribosome-recycling factor OS=Anabaena sp. (strain PCC 7120) GN=frr PE=3 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.957e-44
Identity = 85/143 (59.44%), Postives = 114/143 (79.72%), Query Frame = -2
Query:  222 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSI 650
            +N ++LDK+ V+YYGSP  LKS+A I+TPD++++LIQPYDKSSL  +EKAI  SD+G+TP+NDG VIRL +P LTS+RRKEL K+ AK AEEG+VA+RNIRRDA+ +  KL+K  ++SED  KD    LQKLT++Y  +ID +
Sbjct:   29 ANASLLDKVLVDYYGSPTPLKSLANISTPDATTILIQPYDKSSLNIVEKAISLSDVGLTPSNDGAVIRLNIPPLTSDRRKELVKIAAKYAEEGRVAIRNIRRDAVDSIRKLEKNAEVSEDEAKDQQDKLQKLTNKYTARIDEL 171          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_SYNP6 (Ribosome-recycling factor OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=frr PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 4.270e-43
Identity = 81/143 (56.64%), Postives = 115/143 (80.42%), Query Frame = -2
Query:  222 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSI 650
            +N ++LDKI V+YYGS   LKS+A I+TPD+S+L IQP+D+SS+ +IEKAI  SD+G+TPNNDG++IRL +P LTS+RRKEL K+ AK AEEGKVA+RN+RRDA+ +  KL+K  ++SED+ +D    +QKLTD++  K++ +
Sbjct:   29 ANASLLDKIVVDYYGSETPLKSLASISTPDASTLQIQPFDRSSMGAIEKAISLSDIGLTPNNDGQIIRLNIPPLTSDRRKELVKLAAKYAEEGKVAIRNVRRDAIDSIRKLEKSGEISEDDARDQQDQVQKLTDKFSAKVEQL 171          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_SYNE7 (Ribosome-recycling factor OS=Synechococcus elongatus (strain PCC 7942) GN=frr PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 4.270e-43
Identity = 81/143 (56.64%), Postives = 115/143 (80.42%), Query Frame = -2
Query:  222 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSI 650
            +N ++LDKI V+YYGS   LKS+A I+TPD+S+L IQP+D+SS+ +IEKAI  SD+G+TPNNDG++IRL +P LTS+RRKEL K+ AK AEEGKVA+RN+RRDA+ +  KL+K  ++SED+ +D    +QKLTD++  K++ +
Sbjct:   29 ANASLLDKIVVDYYGSETPLKSLASISTPDASTLQIQPFDRSSMGAIEKAISLSDIGLTPNNDGQIIRLNIPPLTSDRRKELVKLAAKYAEEGKVAIRNVRRDAIDSIRKLEKSGEISEDDARDQQDQVQKLTDKFSAKVEQL 171          
BLAST of CF832535 vs. ExPASy Swiss-Prot
Match: RRF_CYAP4 (Ribosome-recycling factor OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=frr PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 4.270e-43
Identity = 83/143 (58.04%), Postives = 113/143 (79.02%), Query Frame = -2
Query:  222 SNPAMLDKIEVEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSSLKSIEKAIVSSDLGMTPNNDGEVIRLTLPQLTSERRKELSKVVAKQAEEGKVAVRNIRRDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSI 650
            +N ++LD++ VEYYG+   L+S+A I+TPDSS++ IQP+D++SL  IEKAI  SDLG+TPNNDG VIRL +P LTS+RRKEL K  +K AEEGKV++RN+RRDA+ + +K  K  +LSED VKDL   +QKLTD+Y+ K+D +
Sbjct:   29 ANTSLLDRVTVEYYGAETPLRSLANISTPDSSTIAIQPFDRNSLNLIEKAISMSDLGLTPNNDGTVIRLNIPPLTSDRRKELVKTASKLAEEGKVSIRNVRRDAVDSVKKQGKAGELSEDEVKDLQDKIQKLTDKYIAKVDGL 171          
The following BLAST results are available for this feature:
BLAST of CF832535 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RRFC_ARATH3.969e-6585.62Ribosome-recycling factor, chloroplastic OS=Arabid... [more]
RRFC_DAUCA1.155e-6482.19Ribosome-recycling factor, chloroplastic (Fragment... [more]
RRFC_SPIOL3.360e-6483.56Ribosome-recycling factor, chloroplastic OS=Spinac... [more]
RRFC_ORYSJ2.408e-6280.14Ribosome-recycling factor, chloroplastic OS=Oryza ... [more]
RRFC_ORYSI2.408e-6280.14Ribosome-recycling factor, chloroplastic OS=Oryza ... [more]
RRF_SYNJB2.419e-4661.54Ribosome-recycling factor OS=Synechococcus sp. GN=... [more]
RRF_ANASP2.957e-4459.44Ribosome-recycling factor OS=Anabaena sp. (strain ... [more]
RRF_SYNP64.270e-4356.64Ribosome-recycling factor OS=Synechococcus sp. (st... [more]
RRF_SYNE74.270e-4356.64Ribosome-recycling factor OS=Synechococcus elongat... [more]
RRF_CYAP44.270e-4358.04Ribosome-recycling factor OS=Cyanothece sp. (strai... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_02A06_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa02A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832535 ID=CF832535|Name=CF832535|organism=Citrus sinensis|type=EST|length=651bp
TTTTTTTTTTTTTTTTTACAAAGAGTCTAGAATAACTAATTTCCCCCTTT
CATTTCATAACAAAATATCCACCCGTGTCTCCCATTATTATCAAAAAATG
CCATTCTATGGGCAAACCAAAAAATAAAGAGTGCATTCTGAGATTCACTA
GAGAGCTCACCCTTACATTTGTGTGTAAACAATCATTAAACCTTCAACAA
CTCCTTCTCTTTCTGTTTGTAGATGCTATCAATCTTCTTCATATACTCAT
CTGTTAGTTTCTGTAAATCACTTGACAAGTCCTTCACATTGTCTTCAGAG
AGCTTCTTCTCCTTCTGAAGTTTTTCATAAGCTTTTAACGCATCTCTTCT
TATATTCCTAACTGCCACCTTCCCTTCTTCAGCCTGTTTGGCCACAACCT
TTGACAGTTCCTTCCTCCTTTCGGATGTCAATTGAGGAAGGGTTAACCGT
ATGACTTCACCATCATTGTTTGGGGTCATGCCAAGATCAGAGCTCACTAT
GGCCTTCTCTATAGACTTTAAGCTGGATTTGTCATATGGTTGAATCAATA
GAGAACTTGAATCAGGGGTATTGATTTGAGCTATGCTCTTCAAACTTACT
GGGCTTCCATAGTATTCCACCTCAATCTTATCTAGCATAGCTGGATTCGA
T
back to top