CF832537

Overview
NameCF832537
Unique NameCF832537
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length846
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF832537 vs. ExPASy Swiss-Prot
Match: MA2B1_CAVPO (Lysosomal alpha-mannosidase OS=Cavia porcellus GN=MAN2B1 PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.956e-19
Identity = 72/215 (33.49%), Postives = 103/215 (47.91%), Query Frame = -1
Query:  229 VELMLHRRLLLDDSRGVAEALNETDCVLDECKGLTIQGKYYFRIDTIGDGAKWRRTFGQEIYSPPLLAFTEEDGDSWRNSHVTT-----FSGIDSSYSLPDNVAIITLQELDDGKILLRLAHLYQIGED--KDLSKPTNVELKKLFPRKKIGKVTETSLSANQERTEMEKKRLVWKVXXXXXXXXXSKLARGRPVDPK--ELVVELAPMEIRTFI 846
            +ELM+HRRLL DD RGV EAL E         G  ++G++   +DT  + A   R   ++    P L      G S+ + H        FSG+     LP +V ++TL       +LLRL H + +GED  ++LS P  ++L+ LF    I ++ ET+L+ANQ R      RL W                 RP  P+     + L PMEIRTF+
Sbjct:  803 LELMVHRRLLKDDGRGVGEALQEPG------SGGWVRGRHLLLLDTAREAAAEHRLLAEKELLAPQLVLAPGQGPSYHHDHHEAVPRKQFSGL--RRQLPPSVRLLTLARWGPDTLLLRLEHQFALGEDSSRNLSLPVTLDLQDLFSTFTITRLQETTLAANQLRA--SASRLKWTTEIDPI---------SRPAVPRLDPSSITLQPMEIRTFV 998          
BLAST of CF832537 vs. ExPASy Swiss-Prot
Match: MA2B1_MOUSE (Lysosomal alpha-mannosidase OS=Mus musculus GN=Man2b1 PE=2 SV=3)

HSP 1 Score: 90.8929 bits (224), Expect = 9.744e-18
Identity = 73/221 (33.03%), Postives = 107/221 (48.42%), Query Frame = -1
Query:  196 VELMLHRRLLLDDSRGVAEALNETDCVLDECKGLTIQGKYYFRIDTIGDGAKWRRTFG-QEIYSPP-LLAFTEEDGDSWRNSHVTTFSGIDSSYSLPDNVAIITLQELDDGKILLRLAHLYQIGEDKD--LSKPTNVELKKLFPRKKIGKVTETSLSANQERTEMEKKRLVWKVXXXXXXXXXSKLARGRPVDPKELVVELAPMEIRTFIIDFDHKSYRRA 846
            +ELM+HRRLL+DD RGV+E L ETD       G  ++G++   + ++ D A   R    QE+ +P  +L+         R +  T FSG+     LP  V ++TL       +LLRL H + + ED D  LS P  + ++ LF    I  + ET+L+ANQ  +     RL W           +       +DP    V L PMEIRTF+     + +R A
Sbjct:  810 LELMVHRRLLVDDDRGVSEPLLETD------TGDKVRGRHLVLLSSVSDAAARHRLLAEQEVLAPQVVLSLGGSSPYHSRATPKTQFSGL--RQELPPQVHLLTLARWGPKMLLLRLEHQFALKEDSDRNLSSPVTLNVQNLFQTFTINYLQETTLAANQPLS--RASRLKWMT-----NTGPTSFPEPSKLDPTS--VTLKPMEIRTFLASVQWQEHRPA 1013          
BLAST of CF832537 vs. ExPASy Swiss-Prot
Match: MA2B1_BOVIN (Lysosomal alpha-mannosidase OS=Bos taurus GN=MAN2B1 PE=1 SV=3)

HSP 1 Score: 88.5817 bits (218), Expect = 4.836e-17
Identity = 69/210 (32.86%), Postives = 99/210 (47.14%), Query Frame = -1
Query:  229 VELMLHRRLLLDDSRGVAEALNETDCVLDECKGLTIQGKYYFRIDTIGDGAKWRRTFGQEIYSPPLLAFTEEDGDSWR--NSHVTTFSGIDSSYSLPDNVAIITLQELDDGKILLRLAHLYQIGED--KDLSKPTNVELKKLFPRKKIGKVTETSLSANQERTEMEKKRLVWKVXXXXXXXXXSKLARGRPVDPKELVVELAPMEIRTFI 846
            +ELM+HRRLL DD+RGV E LN+      E  GL ++G++   +D     A   R   +     P +   +  G  +R   +  T FSG+     LP +V ++TL       +LLRL H + +GED  ++LS P  ++L  LF    I  + ET+L+ANQ        RL W                  P  P    + L PMEIRTF+
Sbjct:  798 LELMVHRRLLKDDARGVGEPLNK------EGSGLWVRGRHLVLLDKKETAAARHRLQAEMEVLAPQVVLAQGGGARYRLEKAPRTQFSGL--RRELPPSVRLLTLARWGPETLLLRLEHQFAVGEDSGRNLSSPVTLDLTNLFSAFTITNLRETTLAANQ--LLAYASRLQWTT-------DTGPTPHPSPSRPVSATITLQPMEIRTFL 990          
BLAST of CF832537 vs. ExPASy Swiss-Prot
Match: MA2B1_HUMAN (Lysosomal alpha-mannosidase OS=Homo sapiens GN=MAN2B1 PE=1 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 2.400e-16
Identity = 69/216 (31.94%), Postives = 100/216 (46.30%), Query Frame = -1
Query:  211 VELMLHRRLLLDDSRGVAEALNETDCVLDECKGLTIQGKYYFRIDTIGDGAKWRRTFGQEIYSPPLLAFTEEDGDSWRNSHV--TTFSGIDSSYSLPDNVAIITLQELDDGKILLRLAHLYQIGED--KDLSKPTNVELKKLFPRKKIGKVTETSLSANQERTEMEKKRLVWKVXXXXXXXXXSKLARGRPVDPKELVVELAPMEIRTFIIDFDHK 846
            +ELM+HRRLL DD RGV+E L E         G  ++G++   +DT    A   R   ++    P +      G ++       T FSG+     LP +V ++TL       +LLRL H + +GED  ++LS P  + L+ LF    I ++ ET+L ANQ R      RL W                   +DP  + +E  PMEIRTF+     K
Sbjct:  809 LELMVHRRLLKDDGRGVSEPLMENG------SGAWVRGRHLVLLDTAQAAAAGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQFSGL--RRDLPPSVHLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITRLQETTLVANQLRE--AASRLKWTTNTGPTPHQTP-----YQLDPANITLE--PMEIRTFLASVQWK 1007          
BLAST of CF832537 vs. ExPASy Swiss-Prot
Match: MA2B1_MACFA (Lysosomal alpha-mannosidase OS=Macaca fascicularis GN=MAN2B1 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.135e-16
Identity = 69/216 (31.94%), Postives = 100/216 (46.30%), Query Frame = -1
Query:  211 VELMLHRRLLLDDSRGVAEALNETDCVLDECKGLTIQGKYYFRIDTIGDGAKWRRTFGQEIYSPPLLAFTEEDGDSWRNSHV--TTFSGIDSSYSLPDNVAIITLQELDDGKILLRLAHLYQIGED--KDLSKPTNVELKKLFPRKKIGKVTETSLSANQERTEMEKKRLVWKVXXXXXXXXXSKLARGRPVDPKELVVELAPMEIRTFIIDFDHK 846
            +ELM+HRRLL DD RGV+E L E         G  ++G++   +DT    A   R   ++    P +      G ++       T FSG+     LP +V ++TL       +LLRL H + +GED  ++LS P  + L+ LF    I ++ ET+L ANQ R      RL W                   +DP  + +E  PMEIRTF+     K
Sbjct:  810 LELMVHRRLLKDDERGVSEPLMENG------SGAWVRGRHLVLLDTAQAAAAGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQFSGL--RRELPPSVHLLTLASWGPEMLLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITRLQETTLVANQLRE--AASRLKWTTNTGPTPHQTP-----YQLDPANITLE--PMEIRTFLASVQWK 1008          
BLAST of CF832537 vs. ExPASy Swiss-Prot
Match: MA2B1_FELCA (Lysosomal alpha-mannosidase OS=Felis catus GN=MAN2B1 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.983e-16
Identity = 69/209 (33.01%), Postives = 101/209 (48.33%), Query Frame = -1
Query:  229 VELMLHRRLLLDDSRGVAEALNETDCVLDECKGLTIQGKYYFRIDTIGDGAKWRRTFGQEIYSPPLLAFTEEDGDSW--RNSHVTTFSGIDSSYSLPDNVAIITLQELDDGKILLRLAHLYQIGEDK-DLSKPTNVELKKLFPRKKIGKVTETSLSANQERTEMEKKRLVWKVXXXXXXXXXSKLARGRPVDPKELVVELAPMEIRTFI 846
            +ELM+HRRLL DD RGV EAL      L++  G  ++G++   +D +   A   R   ++    P +      G  +  + +    FSG+     LP +V ++TL   D   +LLRL H + +GED  +LS P  ++L  LF    I  + ET+L ANQ R      RL W           + L     +DP    + L PMEIRTF+
Sbjct:  807 MELMVHRRLLKDDGRGVGEAL------LEDGLGRWVRGRHLVLLDKVRTAATGHRLQAEKEVLTPQVVLAPGGGAPYHLKVAPRKQFSGL--RRELPPSVHLLTLARWDQKTLLLRLEHQFAVGEDSGNLSSPVTLDLTDLFSAFTITYLQETTLVANQLRA--SASRLKW-----TPNTGPTPLPSPSRLDP--ATITLQPMEIRTFL 998          
BLAST of CF832537 vs. ExPASy Swiss-Prot
Match: MANA_DICDI (Lysosomal alpha-mannosidase OS=Dictyostelium discoideum GN=manA PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 1.902e-13
Identity = 61/212 (28.77%), Postives = 99/212 (46.70%), Query Frame = -1
Query:  226 VELMLHRRLLLDDSRGVAEALNETDCVLDECKGLTIQGKYYFRIDTIGDGAKWRRTFGQEIYSP--PLLAFTEEDGDSWRNSHVTTFSGIDSSYSLPDNVAIITLQELD--DGKILLRLAHLYQI-GEDKDLSKPTNVELKKLFPRKKIGKVTETSLSANQERTEMEKKRLVWKVXXXXXXXXXSKLARGRPVDPKELVVELAPMEIRTFII 846
            +++M+HRR L DD RGV + +NE+  ++          K  F  D         R     +  P  P+   T++  + W + +   +S + S+  LP+ + I TLQ LD  D  ILLR+ ++YQI G+D    +   ++L  +F    I   TE +L+  Q+ + +   RL WK          S  +  +       V   +PM+IRTFII
Sbjct:  807 LDMMMHRRTLKDDGRGVGQPMNESTQIV-------TTSKLIFH-DISSYAQSHYRPAALSLSHPLLPMFTTTQQSSNDWNSQYQGVYSPLTSASPLPNGLKIQTLQWLDNQDNTILLRIENIYQIDGQDSQDPQTITLDLSTIFSTITITSATEMNLTGVQKLSNL--SRLKWKTVDGKNYDHKSS-SSTKEDSSNGFVFTFSPMQIRTFII 1007          
The following BLAST results are available for this feature:
BLAST of CF832537 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
MA2B1_CAVPO3.956e-1933.49Lysosomal alpha-mannosidase OS=Cavia porcellus GN=... [more]
MA2B1_MOUSE9.744e-1833.03Lysosomal alpha-mannosidase OS=Mus musculus GN=Man... [more]
MA2B1_BOVIN4.836e-1732.86Lysosomal alpha-mannosidase OS=Bos taurus GN=MAN2B... [more]
MA2B1_HUMAN2.400e-1631.94Lysosomal alpha-mannosidase OS=Homo sapiens GN=MAN... [more]
MA2B1_MACFA3.135e-1631.94Lysosomal alpha-mannosidase OS=Macaca fascicularis... [more]
MA2B1_FELCA6.983e-1633.01Lysosomal alpha-mannosidase OS=Felis catus GN=MAN2... [more]
MANA_DICDI1.902e-1328.77Lysosomal alpha-mannosidase OS=Dictyostelium disco... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_02A08_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa02A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832537 ID=CF832537|Name=CF832537|organism=Citrus sinensis|type=EST|length=846bp
TTTTTTTTTTTTTTTTTCAATCAAATTGCCCTCAAAAGATGAGTCCCCTA
TATTTACACTAAGCAAGCTACATTACACATTTTTCACCTGTGGCACACAT
AAGGTCTGACTATGAATACAAGCATAGCACAAGGGAGTAGATTTTGAATA
GCATGAAGCATTTCATGTAGCATTTTGCAGCAATTAAGCATCGAACGCCC
TGCGGTAGGACTTGTGATCGAAGTCGATGATGAAGGTTCGAATTTCCATT
GGAGCAAGTTCCACAACCAGTTCTTTAGGATCCACGGGTCTGCCCCTCGC
CAACTTGGATTCTTCTCCAGAAGAGGAAGAGCCTTCTACTTTCCAGACGA
GTCTCTTTTTTTCCATTTCGGTCCTTTCTTGATTCGCAGATAAACTTGTC
TCTGTCACTTTGCCAATCTTTTTGCGAGGGAACAACTTTTTCAATTCTAC
ATTCGTTGGCTTAGAAAGATCCTTGTCCTCGCCAATCTGATATAAATGAG
CTAACCGAAGGAGAATCTTTCCATCATCAAGCTCCTGAAGCGTAATAATA
GCAACATTATCAGGTAAACTATAGGAGGAATCAATCCCTGAGAAAGTGGT
TACATGAGAATTCCTCCAGCTATCTCCATCCTCCTCGGTAAAGGCTAAAA
GGGGAGGTGAATATATCTCCTGGCCAAAAGTACGACGCCATTTAGCACCG
TCTCCTATGGTATCAATTCTGAAATAATATTTCCCTTGGATTGTCAGTCC
TTTACATTCATCAAGCACGCAGTCAGTTTCATTTAGCGCCTCGGCAACGC
CCCTTGAATCATCAAGCAACAATCTCCTATGAAGCATCAATTCTAC
back to top