CF832897
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CF832897 vs. ExPASy Swiss-Prot
Match: ADHX_MAIZE (Alcohol dehydrogenase class-3 OS=Zea mays GN=FDH PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 4.732e-13 Identity = 33/45 (73.33%), Postives = 36/45 (80.00%), Query Frame = 3 Query: 9 LVDKYMKKEIKVDDYITHNMTLGEINQAFRYMHGGDCLHCVLKMQ 143 LVDKYMKKEIKVD+YITHNM L +IN AF +H G CL CVL MQ Sbjct: 336 LVDKYMKKEIKVDEYITHNMNLADINDAFHLLHEGGCLRCVLAMQ 380
BLAST of CF832897 vs. ExPASy Swiss-Prot
Match: ADHX_ARATH (Alcohol dehydrogenase class-3 OS=Arabidopsis thaliana GN=ADH2 PE=1 SV=2) HSP 1 Score: 70.4774 bits (171), Expect = 4.006e-12 Identity = 31/42 (73.81%), Postives = 36/42 (85.71%), Query Frame = 3 Query: 9 LVDKYMKKEIKVDDYITHNMTLGEINQAFRYMHGGDCLHCVL 134 LV+KYM KEIKVD+YITHN+TLGEIN+AF +H G CL CVL Sbjct: 334 LVEKYMNKEIKVDEYITHNLTLGEINKAFDLLHEGTCLRCVL 375
BLAST of CF832897 vs. ExPASy Swiss-Prot
Match: ADHX_PEA (Alcohol dehydrogenase class-3 OS=Pisum sativum PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 5.232e-12 Identity = 31/46 (67.39%), Postives = 38/46 (82.61%), Query Frame = 3 Query: 9 LVDKYMKKEIKVDDYITHNMTLGEINQAFRYMHGGDCLHCVLKMQD 146 LV+KY+KKEIKVD+YITHN+TL EIN+AF +H G CL CVL + D Sbjct: 333 LVEKYLKKEIKVDEYITHNLTLLEINKAFDLLHEGQCLRCVLAVHD 378 The following BLAST results are available for this feature:
BLAST of CF832897 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF832897 ID=CF832897; Name=CF832897; organism=Citrus sinensis; type=EST; length=466bpback to top |