CF834295

Overview
NameCF834295
Unique NameCF834295
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length598
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1234 contig Csv1_Contig1234:1033..1629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK1_SOLTU (S-adenosylmethionine synthetase 1 OS=Solanum tuberosum GN=METK1 PE=2 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 7.512e-65
Identity = 119/130 (91.54%), Postives = 124/130 (95.38%), Query Frame = -2
Query:  208 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQ 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVASGLA RCIVQVSYAIGVPEPLS+FVD+YGTGKIPDKEILKIVKE+ DFRPGMM+INLDLKRGGNGRFLK AAYGHFGRDDPDFTWEVVKPLKWEKPQ
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENFDFRPGMMSINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQ 392          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK_MEDTR (S-adenosylmethionine synthetase OS=Medicago truncatula GN=METK PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.085e-63
Identity = 116/131 (88.55%), Postives = 124/131 (94.66%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAY+VRQAAKSIVA+GLA RCIVQVSYAIGVPEPLS+FVDSYGTGKIPD+EIL+IVKE+ DFRPGM+TINLDLKRGGN RFLK AAYGHFGRDDPDFTWEVVKPLKWEKPQA
Sbjct:  264 GAHGGGAFSGKDPTKVDRSGAYVVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDREILQIVKENFDFRPGMITINLDLKRGGNSRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 394          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK2_ELAUM (S-adenosylmethionine synthetase 2 OS=Elaeagnus umbellata GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.085e-63
Identity = 116/131 (88.55%), Postives = 124/131 (94.66%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVA+GLA RCIVQVSYAIGVP+PLS+FVDSYGTGKIPDKEILKIVKE+ DFRPGM+TINLDLKRGGN RFLK AAYGHFGRDDPDFTWE+VKPLKWEKPQ+
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPDPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMITINLDLKRGGNDRFLKTAAYGHFGRDDPDFTWEIVKPLKWEKPQS 393          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK1_SOLLC (S-adenosylmethionine synthetase 1 OS=Solanum lycopersicum GN=SAM1 PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 1.417e-63
Identity = 117/130 (90.00%), Postives = 123/130 (94.62%), Query Frame = -2
Query:  208 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQ 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVASGLA RCIVQVSYAIGVPEPLS+FVD+YGTGKIPD+EILKIVKE+ DFRPGMM+INLDLKRGGN RFLK AAYGHFGRDDPDFTWEVVKPLKWEKPQ
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDREILKIVKENFDFRPGMMSINLDLKRGGNRRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQ 392          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK1_POPTR (S-adenosylmethionine synthetase 1 OS=Populus trichocarpa GN=METK1 PE=2 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 2.417e-63
Identity = 119/131 (90.84%), Postives = 124/131 (94.66%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVA+GLA RCIVQVSYAIGVPEPLS+FVD+YGTGKIPDKEILKIVKE+ DFRPGMMTINLDLKRGGN RFLK AAYGHFGRDDPDFTWEVVKPLKWEKPQA
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENFDFRPGMMTINLDLKRGGN-RFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 392          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK2_VITVI (S-adenosylmethionine synthetase 2 OS=Vitis vinifera GN=METK2 PE=3 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 3.156e-63
Identity = 116/131 (88.55%), Postives = 124/131 (94.66%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVA+GLA RCIVQVSYAIGVPEPLS+FVD+YGTGKIPD+EILKIVKE+ DFRPGM++INLDLKRGGNGRFLK AAYGHFGRDDPDFTWEVVKPLKWEK QA
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDREILKIVKENFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKTQA 393          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK3_ACTCH (S-adenosylmethionine synthetase 3 (Fragment) OS=Actinidia chinensis GN=SAM3 PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 4.122e-63
Identity = 117/130 (90.00%), Postives = 122/130 (93.85%), Query Frame = -2
Query:  208 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQ 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVASGLA RCIVQVSYAIGVPEPLS+FVD+YGTGKIPDKEILKIVKES DFRPGM+ I+LDLKRGGNGRFLK AAYGHFGRDD DFTWEVVKPLKWEKPQ
Sbjct:  230 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKESFDFRPGMIAIHLDLKRGGNGRFLKTAAYGHFGRDDADFTWEVVKPLKWEKPQ 359          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK1_ELAUM (S-adenosylmethionine synthetase 1 OS=Elaeagnus umbellata GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 4.122e-63
Identity = 114/131 (87.02%), Postives = 123/131 (93.89%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVA+GLA RC+VQVSYAIGVPEPLS+FVDSYGTG+IPDKEIL IVKE+ DFRPGM+TINLDLKRGGNGRFLK A YGHFGRDDPDFTWE+VKPLKWEKPQ+
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCLVQVSYAIGVPEPLSVFVDSYGTGQIPDKEILNIVKENFDFRPGMITINLDLKRGGNGRFLKTAGYGHFGRDDPDFTWEIVKPLKWEKPQS 393          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK_SOLBR (S-adenosylmethionine synthetase OS=Solanum brevidens GN=SAMS PE=2 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 5.384e-63
Identity = 116/130 (89.23%), Postives = 122/130 (93.85%), Query Frame = -2
Query:  208 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQ 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVASGLA RCIVQVSYAIGVPEPLS+FVD+YGTGKIPD+EILKIVKE+ DFRPGMM+INLDLKRGGNGRFLK AAYGHFGRDD DFTWEVVKPLKWE PQ
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDREILKIVKENFDFRPGMMSINLDLKRGGNGRFLKTAAYGHFGRDDADFTWEVVKPLKWENPQ 392          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK_BRARP (S-adenosylmethionine synthetase OS=Brassica rapa subsp. pekinensis GN=SAMS PE=2 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 5.384e-63
Identity = 115/131 (87.79%), Postives = 123/131 (93.89%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKS+VA+G+A R +VQVSYAIGVPEPLS+FVD+YGTG IPDKEILKIVKES DFRPGMMTINLDLKRGGNGRFLK AAYGHFGRDDPDFTWEVVKPLKW+KPQA
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVANGMARRALVQVSYAIGVPEPLSVFVDTYGTGLIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA 393          
The following BLAST results are available for this feature:
BLAST of CF834295 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK1_SOLTU7.512e-6591.54S-adenosylmethionine synthetase 1 OS=Solanum tuber... [more]
METK_MEDTR1.085e-6388.55S-adenosylmethionine synthetase OS=Medicago trunca... [more]
METK2_ELAUM1.085e-6388.55S-adenosylmethionine synthetase 2 OS=Elaeagnus umb... [more]
METK1_SOLLC1.417e-6390.00S-adenosylmethionine synthetase 1 OS=Solanum lycop... [more]
METK1_POPTR2.417e-6390.84S-adenosylmethionine synthetase 1 OS=Populus trich... [more]
METK2_VITVI3.156e-6388.55S-adenosylmethionine synthetase 2 OS=Vitis vinifer... [more]
METK3_ACTCH4.122e-6390.00S-adenosylmethionine synthetase 3 (Fragment) OS=Ac... [more]
METK1_ELAUM4.122e-6387.02S-adenosylmethionine synthetase 1 OS=Elaeagnus umb... [more]
METK_SOLBR5.384e-6389.23S-adenosylmethionine synthetase OS=Solanum brevide... [more]
METK_BRARP5.384e-6387.79S-adenosylmethionine synthetase OS=Brassica rapa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05E14_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05E14, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834295 ID=CF834295; Name=CF834295; organism=Citrus sinensis; type=EST; length=598bp
GGAACATTAAACCAAAACCAAAAAAGACCTCGGGGAAAGAAGAAAAAGAA
AGGAATTGAATGGGGAACATGTATGAGTTCCGAACACAGGAGATTTGCTT
AGTATTACAAAGCAGCAGCAAGATAATATTCAAATTATTCATCCACTACC
AATAGAAGCAAACTTGAACAGGAGGGATAGTTTGCACTTTTCAACTCAAA
TTTAAGCTTGAGGCTTTTCCCACTTGAGGGGCTTCACAACTTCCCAAGTG
AAGTCTGGGTCATCCCTGCCAAAGTGTCCATAGGCAGCAGGCTTCAAGAA
CCTGCCATTACCGCCCCTTTTGAGATCCAAATTGATGGTCATCATTCCTG
GCCTGAAATCAGAGCTTTCCTTCACAATTTTGAGGATCTCCTTGTCAGGA
ATCTTGCCGGTTCCATATGAGTCCACAAAAAGAGACAATGGCTCAGGCAC
ACCTATGGCATACGAGACTTGGACAATGCACCTGGGAGCAAGCCCGCTTG
CAACAATGCTCTTAGCAGCCTGCCTAACAATGTATGCACCAGTCCTATCC
ACCTTAGGAGGGTCTTTTCCAAAGAAAGCACAGCCACCATGGGCTCCC
back to top