CF834296

Overview
NameCF834296
Unique NameCF834296
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length413
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1234 contig Csv1_Contig1234:540..952. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF834296 vs. ExPASy Swiss-Prot
Match: METK1_POPTR (S-adenosylmethionine synthetase 1 OS=Populus trichocarpa GN=METK1 PE=2 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 1.535e-72
Identity = 129/137 (94.16%), Postives = 132/137 (96.35%), Query Frame = 3
Query:    3 KSPPIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTHHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 413
            +SP IAQGVHGHFTKRPE+IGAGDQGHMFGYATDET E+MPLSHVLATKLGARLTEVRKN TC WLRPDGKTQVTVEYYNDNGAMVPVRVHTVLIST HDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS
Sbjct:   99 QSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 235          
BLAST of CF834296 vs. ExPASy Swiss-Prot
Match: METK1_ELAUM (S-adenosylmethionine synthetase 1 OS=Elaeagnus umbellata GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 4.465e-72
Identity = 128/137 (93.43%), Postives = 132/137 (96.35%), Query Frame = 3
Query:    3 KSPPIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTHHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 413
            +SP IAQGVHGHFTKRPE+IGAGDQGHMFGYATDET E+MPLSHVLATKLGARLTEVRKN TC WLRPDGKTQVTVEYYN+NGAMVPVRVHTVLIST HDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS
Sbjct:   99 QSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 235          
BLAST of CF834296 vs. ExPASy Swiss-Prot
Match: METK_CARPA (S-adenosylmethionine synthetase OS=Carica papaya GN=SAMS PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 9.947e-72
Identity = 128/137 (93.43%), Postives = 131/137 (95.62%), Query Frame = 3
Query:    3 KSPPIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTHHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 413
            +SP IAQGVHGHFTKRPE+IGAGDQGHMFGYATDET EFMPLSHVLATKLGARLTEVRKN TC WLRPDGKTQVTVEYYN+NGA VPVRVHTVLIST HDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS
Sbjct:   99 QSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGARVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 235          
BLAST of CF834296 vs. ExPASy Swiss-Prot
Match: METK_POPDE (S-adenosylmethionine synthetase OS=Populus deltoides GN=METK PE=2 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 1.697e-71
Identity = 127/137 (92.70%), Postives = 132/137 (96.35%), Query Frame = 3
Query:    3 KSPPIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTHHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 413
            +SP IAQGVHGHF+KRPE+IGAGDQGHMFGYATDET E MPLSHVLATKLGARLTEVRKN TC+WLRPDGKTQVTVEYYN+NGAMVPVRVHTVLIST HDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS
Sbjct:  100 QSPDIAQGVHGHFSKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 236          
BLAST of CF834296 vs. ExPASy Swiss-Prot
Match: METK3_POPTR (S-adenosylmethionine synthetase 3 OS=Populus trichocarpa GN=METK3 PE=2 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 1.697e-71
Identity = 127/137 (92.70%), Postives = 132/137 (96.35%), Query Frame = 3
Query:    3 KSPPIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTHHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 413
            +SP IAQGVHGHF+KRPE+IGAGDQGHMFGYATDET E MPLSHVLATKLGARLTEVRKN TC+WLRPDGKTQVTVEYYN+NGAMVPVRVHTVLIST HDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS
Sbjct:  100 QSPDIAQGVHGHFSKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 236          
BLAST of CF834296 vs. ExPASy Swiss-Prot
Match: METK_PHALU (S-adenosylmethionine synthetase OS=Phaseolus lunatus GN=SAMS PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 2.216e-71
Identity = 128/137 (93.43%), Postives = 130/137 (94.89%), Query Frame = 3
Query:    3 KSPPIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTHHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 413
            +SP IAQGVHGH TKRPE+IGAGDQGHMFGYATDET E MPLSHVLATKLGARLTEVRKN TCSWLRPDGKTQVTVEYYND GAMVPVRVHTVLIST HDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS
Sbjct:  100 QSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCSWLRPDGKTQVTVEYYNDKGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 236          
BLAST of CF834296 vs. ExPASy Swiss-Prot
Match: METK2_ARATH (S-adenosylmethionine synthetase 2 OS=Arabidopsis thaliana GN=SAM2 PE=1 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 2.216e-71
Identity = 126/137 (91.97%), Postives = 130/137 (94.89%), Query Frame = 3
Query:    3 KSPPIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTHHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 413
            +SP IAQGVHGHFTKRPEDIGAGDQGHMFGYATDET E MPLSHVLATK+GARLTEVRKN TC WLRPDGKTQVTVEYYNDNGAMVPVRVHTVLIST HDETVTNDEIA DLKEHVIKP+IPEKYLD+KTIFHLNPS
Sbjct:   99 QSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGARLTEVRKNGTCRWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIARDLKEHVIKPIIPEKYLDDKTIFHLNPS 235          
BLAST of CF834296 vs. ExPASy Swiss-Prot
Match: METK1_BETVU (S-adenosylmethionine synthetase 1 OS=Beta vulgaris GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 2.216e-71
Identity = 127/137 (92.70%), Postives = 130/137 (94.89%), Query Frame = 3
Query:    3 KSPPIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTHHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 413
            +SP IAQGVHGH TKRPE+IGAGDQGHMFGYATDET E MPLSHVLATKLGARLTEVRKN TC WLRPDGKTQVTVEYYNDNGAMVP+RVHTVLIST HDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS
Sbjct:  103 QSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNDNGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 239          
BLAST of CF834296 vs. ExPASy Swiss-Prot
Match: METK_WHEAT (S-adenosylmethionine synthetase OS=Triticum aestivum GN=SAMS PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 2.894e-71
Identity = 126/137 (91.97%), Postives = 132/137 (96.35%), Query Frame = 3
Query:    3 KSPPIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTHHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 413
            +SP IAQGVHGHFTKRPE+IGAGDQGHMFGYATDET EFMPLSHVLATKLGARLTEVRKN+TC WLRPDGKTQVTVEY+NDNGAMVP+RVHTVLIST HDETVTNDEIAADLKEHVIKPVIPE+YLDE TIFHLNPS
Sbjct:  102 QSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNATCPWLRPDGKTQVTVEYHNDNGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEQYLDENTIFHLNPS 238          
BLAST of CF834296 vs. ExPASy Swiss-Prot
Match: METK4_HORVU (S-adenosylmethionine synthetase 4 OS=Hordeum vulgare GN=SAM4 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 2.894e-71
Identity = 126/137 (91.97%), Postives = 132/137 (96.35%), Query Frame = 3
Query:    3 KSPPIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTHHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPS 413
            +SP IAQGVHGHFTKRPE+IGAGDQGHMFGYATDET EFMPLSHVLATKLGARLTEVRKN+TC WLRPDGKTQVTVEY+NDNGAMVP+RVHTVLIST HDETVTNDEIAADLKEHVIKPVIPE+YLDE TIFHLNPS
Sbjct:  102 QSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNATCPWLRPDGKTQVTVEYHNDNGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEQYLDENTIFHLNPS 238          
The following BLAST results are available for this feature:
BLAST of CF834296 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK1_POPTR1.535e-7294.16S-adenosylmethionine synthetase 1 OS=Populus trich... [more]
METK1_ELAUM4.465e-7293.43S-adenosylmethionine synthetase 1 OS=Elaeagnus umb... [more]
METK_CARPA9.947e-7293.43S-adenosylmethionine synthetase OS=Carica papaya G... [more]
METK_POPDE1.697e-7192.70S-adenosylmethionine synthetase OS=Populus deltoid... [more]
METK3_POPTR1.697e-7192.70S-adenosylmethionine synthetase 3 OS=Populus trich... [more]
METK_PHALU2.216e-7193.43S-adenosylmethionine synthetase OS=Phaseolus lunat... [more]
METK2_ARATH2.216e-7191.97S-adenosylmethionine synthetase 2 OS=Arabidopsis t... [more]
METK1_BETVU2.216e-7192.70S-adenosylmethionine synthetase 1 OS=Beta vulgaris... [more]
METK_WHEAT2.894e-7191.97S-adenosylmethionine synthetase OS=Triticum aestiv... [more]
METK4_HORVU2.894e-7191.97S-adenosylmethionine synthetase 4 OS=Hordeum vulga... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05E14_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05E14, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834296 ID=CF834296; Name=CF834296; organism=Citrus sinensis; type=EST; length=413bp
CAAAAAGCCCCCCTATTGCCCAGGGTGTTCATGGCCACTTTACAAAGCGC
CCCGAGGACATTGGTGCTGGTGACCAGGGCCATATGTTTGGTTATGCTAC
TGATGAGACCTCTGAATTTATGCCTTTGAGCCATGTCCTTGCCACCAAAC
TTGGTGCTCGTCTCACGGAGGTTAGGAAGAATAGTACCTGCTCTTGGCTA
AGGCCCGATGGGAAAACCCAGGTCACTGTTGAGTACTACAACGACAATGG
TGCCATGGTCCCAGTCCGTGTCCACACGGTCCTCATTTCAACCCACCATG
ATGAGACTGTCACAAATGATGAAATTGCTGCTGACCTTAAGGAGCACGTC
ATTAAGCCTGTCATCCCCGAGAAGTACCTTGATGAGAAGACCATCTTCCA
CCTTAATCCATCA
back to top