CF834301

Overview
NameCF834301
Unique NameCF834301
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length454
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5131 contig Csv1_Contig5131:1139..1590. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF834301 vs. ExPASy Swiss-Prot
Match: MDARS_CUCSA (Monodehydroascorbate reductase, seedling isozyme OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.960e-40
Identity = 76/94 (80.85%), Postives = 85/94 (90.43%), Query Frame = 1
Query:   13 YDYLPYFPFQAFDLSWQFYGDHVGDTVLFGDNDPASATHKFGTYWIKDGKVVGVFLESGTPEENKAIAKVARVQPSVESLDVLKNEGLSFASKI 294
            YDYLPYF  ++FDLSWQFYGD+VGD VLFGDN P SATHKFG+YWIKDGKVVG FLESG+PEENKAIAKVAR+QPSVES D+L  EG+SFASK+
Sbjct:  341 YDYLPYFYSRSFDLSWQFYGDNVGDAVLFGDNSPDSATHKFGSYWIKDGKVVGAFLESGSPEENKAIAKVARIQPSVESSDLLLKEGISFASKV 434          
BLAST of CF834301 vs. ExPASy Swiss-Prot
Match: MDAR_PEA (Monodehydroascorbate reductase OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 6.970e-38
Identity = 73/98 (74.49%), Postives = 85/98 (86.73%), Query Frame = 1
Query:    1 TVTGYDYLPYFPFQAFDLSWQFYGDHVGDTVLFGDNDPASATHKFGTYWIKDGKVVGVFLESGTPEENKAIAKVARVQPSVESLDVLKNEGLSFASKI 294
            +V  YDYLPYF  ++FDLSWQFYGD+VG+TVLFGDNDPAS+  KFGTYWIK+GKVVG FLE GTP+ENKAIAKVAR +P+VE ++ L  EGLSFASKI
Sbjct:  336 SVEEYDYLPYFYSRSFDLSWQFYGDNVGETVLFGDNDPASSKPKFGTYWIKEGKVVGAFLEGGTPDENKAIAKVARAKPAVEDVNQLAEEGLSFASKI 433          
BLAST of CF834301 vs. ExPASy Swiss-Prot
Match: MDAR_SOLLC (Monodehydroascorbate reductase OS=Solanum lycopersicum GN=AFRR PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 1.553e-37
Identity = 75/98 (76.53%), Postives = 84/98 (85.71%), Query Frame = 1
Query:    1 TVTGYDYLPYFPFQAFDLSWQFYGDHVGDTVLFGDNDPASATHKFGTYWIKDGKVVGVFLESGTPEENKAIAKVARVQPSVESLDVLKNEGLSFASKI 294
            +V  YDYLPYF  +AFDLSWQFYGD+VG+TVLFGD DP SATHKFG YWIKDGK+VG FLESG+PEENKAIAKVA+VQP   +LD L  EG+SFASKI
Sbjct:  337 SVDEYDYLPYFYSRAFDLSWQFYGDNVGETVLFGDADPNSATHKFGQYWIKDGKIVGAFLESGSPEENKAIAKVAKVQPPA-TLDQLAQEGISFASKI 433          
BLAST of CF834301 vs. ExPASy Swiss-Prot
Match: MDAR1_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 1 OS=Arabidopsis thaliana GN=At3g09940 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 5.900e-37
Identity = 72/97 (74.23%), Postives = 82/97 (84.54%), Query Frame = 1
Query:    1 TVTGYDYLPYFPFQAFDLSWQFYGDHVGDTVLFGDNDPASATHKFGTYWIKDGKVVGVFLESGTPEENKAIAKVARVQPSVESLDVLKNEGLSFASK 291
            T+  YDYLPYF  + F LSW+FYG++VG++VLFGDNDP S   KFGTYW+KDGKVVGVFLE GT EE+KAIAKVAR QPSVESLDVL  EGLSFA+K
Sbjct:  339 TIPDYDYLPYFYSRFFKLSWEFYGENVGESVLFGDNDPKSPKPKFGTYWVKDGKVVGVFLEGGTQEEHKAIAKVARAQPSVESLDVLSEEGLSFATK 435          
BLAST of CF834301 vs. ExPASy Swiss-Prot
Match: MDAR4_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 4 OS=Arabidopsis thaliana GN=At5g03630 PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 4.995e-36
Identity = 70/98 (71.43%), Postives = 82/98 (83.67%), Query Frame = 1
Query:    1 TVTGYDYLPYFPFQAFDLSWQFYGDHVGDTVLFGDNDPASATHKFGTYWIKDGKVVGVFLESGTPEENKAIAKVARVQPSVESLDVLKNEGLSFASKI 294
            ++  YDYLPYF  +AFDLSWQFYGD+VG++VLFGDNDP S   KFG+YWIK+ KVVG FLE G+PEEN AIAK+AR QPSVESL+VL  EGLSFA+ I
Sbjct:  338 SIPEYDYLPYFYSRAFDLSWQFYGDNVGESVLFGDNDPESPKPKFGSYWIKERKVVGAFLEGGSPEENNAIAKLARAQPSVESLEVLSKEGLSFATNI 435          
BLAST of CF834301 vs. ExPASy Swiss-Prot
Match: MDAR3_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 3 OS=Arabidopsis thaliana GN=At3g52880 PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 2.836e-31
Identity = 59/97 (60.82%), Postives = 80/97 (82.47%), Query Frame = 1
Query:    4 VTGYDYLPYFPFQAFDLSWQFYGDHVGDTVLFGDNDPASATHKFGTYWIKDGKVVGVFLESGTPEENKAIAKVARVQPSVESLDVLKNEGLSFASKI 294
            V  YDYLP+F  ++FDLSWQFYGD+VGD+VLFGD++P++   +FG YW++ GKVVG F+E G+ +ENKA+AKVA+ +PS ESLD L  +G+SFA+KI
Sbjct:  338 VEEYDYLPFFYSRSFDLSWQFYGDNVGDSVLFGDSNPSNPKPRFGAYWVQGGKVVGAFMEGGSGDENKALAKVAKARPSAESLDELVKQGISFAAKI 434          
BLAST of CF834301 vs. ExPASy Swiss-Prot
Match: MDARF_CUCSA (Monodehydroascorbate reductase, fruit isozyme (Fragments) OS=Cucumis sativus PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 7.742e-21
Identity = 54/87 (62.07%), Postives = 62/87 (71.26%), Query Frame = 1
Query:    1 TVTGYDYLPYFPFQAFDLSWQFYGDHVGDTVLFGDNDPASATHKFGTYWIKDGKVVGVFLESGTPEENKAIAKVARVQPSVESLDVL 261
            ++  YDYLPYF  + F+L+WQFYGD+VG+TVLF DN        FGTYWI   KVVGVFLE GTP+E     KVARVQP VESLD L
Sbjct:   93 SIEEYDYLPYFYSRTFNLAWQFYGDNVGETVLFPDN--------FGTYWI---KVVGVFLEGGTPDE----YKVARVQPPVESLDQL 164          
BLAST of CF834301 vs. ExPASy Swiss-Prot
Match: MDAR2_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 2 OS=Arabidopsis thaliana GN=At3g27820 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.754e-18
Identity = 44/95 (46.32%), Postives = 61/95 (64.21%), Query Frame = 1
Query:   13 YDYLPYFPFQAFDLSWQFYGDHVGDTVLFGDNDPASATHKFGTYWIKDGKVVGVFLESGTPEENKAIAKVARVQPSVE-SLDVLKNEGLSFASKI 294
            +DYLP+F  + F  SWQFYGD  GD V FG+ +   +   FG YW+K G +VG FLE GT EE + I+K  +++P+V   L+ L+ EGL FA  +
Sbjct:  337 FDYLPFFYSRVFAFSWQFYGDPTGDVVHFGEYEDGKS---FGAYWVKKGHLVGSFLEGGTKEEYETISKATQLKPAVTIDLEELEREGLGFAHTV 428          
BLAST of CF834301 vs. ExPASy Swiss-Prot
Match: MDARP_ARATH (Monodehydroascorbate reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g63940 PE=2 SV=3)

HSP 1 Score: 78.9518 bits (193), Expect = 1.083e-14
Identity = 41/101 (40.59%), Postives = 60/101 (59.41%), Query Frame = 1
Query:   13 YDYLPYFPFQAFDLS-------WQFYGDHVGDTVLFGDNDPASATHKFGTYWIKDGKVVGVFLESGTPEENKAIAKVARVQPSVESLDVLKNEGLSFASKI 294
            YDYLPYF  + F+         WQF+GD+VG+TV  G+ DP     K  T+WI+ G++ GV +ESG+PEE + + K+AR QP V+   +     +  A +I
Sbjct:  391 YDYLPYFYSRVFEYEGSPRKVWWQFFGDNVGETVEVGNFDP-----KIATFWIESGRLKGVLVESGSPEEFQLLPKLARSQPLVDKAKLASASSVEEALEI 486          
The following BLAST results are available for this feature:
BLAST of CF834301 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MDARS_CUCSA1.960e-4080.85Monodehydroascorbate reductase, seedling isozyme O... [more]
MDAR_PEA6.970e-3874.49Monodehydroascorbate reductase OS=Pisum sativum PE... [more]
MDAR_SOLLC1.553e-3776.53Monodehydroascorbate reductase OS=Solanum lycopers... [more]
MDAR1_ARATH5.900e-3774.23Probable monodehydroascorbate reductase, cytoplasm... [more]
MDAR4_ARATH4.995e-3671.43Probable monodehydroascorbate reductase, cytoplasm... [more]
MDAR3_ARATH2.836e-3160.82Probable monodehydroascorbate reductase, cytoplasm... [more]
MDARF_CUCSA7.742e-2162.07Monodehydroascorbate reductase, fruit isozyme (Fra... [more]
MDAR2_ARATH2.754e-1846.32Probable monodehydroascorbate reductase, cytoplasm... [more]
MDARP_ARATH1.083e-1440.59Monodehydroascorbate reductase, chloroplastic OS=A... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05E17_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05E17, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834301 ID=CF834301; Name=CF834301; organism=Citrus sinensis; type=EST; length=454bp
ACAGTTACTGGATACGACTATCTCCCATACTTCCCTTTTCAAGCCTTTGA
TCTGTCATGGCAGTTCTATGGAGACCATGTCGGTGACACCGTGCTGTTTG
GGGACAACGATCCGGCATCAGCAACCCATAAGTTTGGAACATACTGGATC
AAAGATGGAAAAGTTGTTGGGGTTTTTCTTGAGAGTGGAACTCCAGAAGA
AAACAAAGCCATTGCCAAAGTTGCTAGGGTCCAACCTTCAGTTGAAAGCT
TGGATGTGCTGAAAAATGAGGGTCTTTCCTTTGCTAGCAAGATCTGAGAA
TGCTTTATTTAGAGGGGATAATAATATTGTGATTTCAGAGCAACTGTTTT
GAAAAATATATCTTATTTGCTTTTAAACTTGTTGGTTTTGTAAGTCTACG
TTTGGGATTTGGTTAAATAAATGCTATAATTTGGTTTCAAAAAAAAAAAA
AAAA
back to top