CF834313

Overview
NameCF834313
Unique NameCF834313
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length454
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6651 contig Csv1_Contig6651:110..563. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF834313 vs. ExPASy Swiss-Prot
Match: PPA1_SOLLC (Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.757e-20
Identity = 41/82 (50.00%), Postives = 60/82 (73.17%), Query Frame = 3
Query:  207 LSCLSWRLRVETSNVIGWATVPKKCAGYEGHYMSGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYA 452
            L C +WR  VET+N+  W T+P++CA Y   YM G  Y+M+ + V++EA  YA+S+ L  DG+++W+FD+DET LSNLPYY+
Sbjct:   41 LKCTTWRFVVETNNLSPWKTIPEECADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLGDDGRDVWIFDVDETLLSNLPYYS 122          
BLAST of CF834313 vs. ExPASy Swiss-Prot
Match: VSP2_ARATH (Vegetative storage protein 2 OS=Arabidopsis thaliana GN=VSP2 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.692e-18
Identity = 52/132 (39.39%), Postives = 75/132 (56.82%), Query Frame = 3
Query:   78 SMDIRHLFLATISATSPGFSMDIPHQI------HLLRPKAGSRNNDVPGLSCLSWRLRVETSNVIGWATVPKKCAGY-EGHYMSGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYA 452
            S+ +  L  AT+SA+ PG    +  +        LL  +  S N      +C SW L VETSN+I + TVP  C  Y E + ++ +QY+ DS+ V  EA  YA+ L L  D  N+W+FD+D+T LS++PYYA
Sbjct:    5 SLSLLLLLAATVSASVPGLIELVDSKTIFGNVAELLEKEKLSINY----ANCRSWHLGVETSNIIDFDTVPANCKDYVEDYLITSKQYQYDSKTVCKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYA 132          
BLAST of CF834313 vs. ExPASy Swiss-Prot
Match: VSP1_ARATH (Vegetative storage protein 1 OS=Arabidopsis thaliana GN=VSP1 PE=2 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 3.516e-18
Identity = 54/135 (40.00%), Postives = 74/135 (54.81%), Query Frame = 3
Query:   78 SMDIRHLFLATISATSPGFSMDIPHQIHLLRPKAGSRNN----DVPGLS-----CLSWRLRVETSNVIGWATVPKKCAGY-EGHYMSGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYA 452
            S+ +  L  AT+S      S  +P  I LL       N     +  GLS     C SW L VETSN+I + TVP  C  Y E + ++ +QY+ DS+ V  EA  YA+ L L  D  N+W+FD+D+T LS++PYYA
Sbjct:    5 SLSLLLLLAATVSHVQS--SASVPGLIELLESNTIFGNEAELLEKEGLSINYPNCRSWHLGVETSNIINFDTVPANCKAYVEDYLITSKQYQYDSKTVNKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYA 137          
BLAST of CF834313 vs. ExPASy Swiss-Prot
Match: VSPA_SOYBN (Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 8.106e-15
Identity = 37/83 (44.58%), Postives = 53/83 (63.86%), Query Frame = 3
Query:  201 PGLSCLSWRLRVETSNVIGWATVPKKCAGYEGHYMSGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYY 449
            P + C SWRL VE  N+ G+ T+P++C      Y+ G+QYR DS+ V  +A  YA+ L++    K+ +VF ID T LSN+PYY
Sbjct:   38 PEVKCASWRLAVEAHNIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARDLEV--HPKDTFVFSIDGTVLSNIPYY 118          
BLAST of CF834313 vs. ExPASy Swiss-Prot
Match: S25K_SOYBN (Stem 31 kDa glycoprotein (Fragment) OS=Glycine max GN=VSP25 PE=2 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 8.106e-15
Identity = 37/83 (44.58%), Postives = 53/83 (63.86%), Query Frame = 3
Query:  201 PGLSCLSWRLRVETSNVIGWATVPKKCAGYEGHYMSGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYY 449
            P + C SWRL VE  N+ G+ T+P++C      Y+ G+QYR DS+ V  +A  YA+ L++    K+ +VF ID T LSN+PYY
Sbjct:   35 PEVKCASWRLAVEAHNIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARDLEV--HPKDTFVFSIDGTVLSNIPYY 115          
BLAST of CF834313 vs. ExPASy Swiss-Prot
Match: VSPB_SOYBN (Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 2.441e-11
Identity = 34/90 (37.78%), Postives = 55/90 (61.11%), Query Frame = 3
Query:  180 GSRNNDVPGLSCLSWRLRVETSNVIGWATVPKKCAGYEGHYMSGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYY 449
            G R+++V    C S+RL VE  N+  + T+P++C      Y++G+Q+R DS+ V  +A  YA   ++     +I++F ID T LSN+PYY
Sbjct:   35 GERSSEV---KCASFRLAVEAHNIRAFKTIPEECVEPTKDYINGEQFRSDSKTVNQQAFFYASEREV--HHNDIFIFGIDNTVLSNIPYY 119          
The following BLAST results are available for this feature:
BLAST of CF834313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
PPA1_SOLLC3.757e-2050.00Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1... [more]
VSP2_ARATH2.692e-1839.39Vegetative storage protein 2 OS=Arabidopsis thalia... [more]
VSP1_ARATH3.516e-1840.00Vegetative storage protein 1 OS=Arabidopsis thalia... [more]
VSPA_SOYBN8.106e-1544.58Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE... [more]
S25K_SOYBN8.106e-1544.58Stem 31 kDa glycoprotein (Fragment) OS=Glycine max... [more]
VSPB_SOYBN2.441e-1137.78Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05F04_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05F04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834313 ID=CF834313; Name=CF834313; organism=Citrus sinensis; type=EST; length=454bp
TAATGAGCATCCCTTAAGAGTCACTGACATTATTCTTCTTTTTTCTGGCT
ACCCTATCAGCAACATCCCATGGATTTAGCATGGACATCCGCCATCTTTT
TCTGGCTACCATATCAGCAACATCCCCTGGATTTAGCATGGACATCCCCC
ATCAGATTCATCTTCTCCGACCGAAAGCCGGTTCCCGGAACAACGATGTT
CCCGGCTTGTCCTGCCTGAGTTGGCGACTCAGAGTGGAAACTAGTAACGT
TATAGGATGGGCGACTGTTCCCAAAAAATGTGCAGGCTACGAGGGGCATT
ACATGTCAGGCCAGCAGTACCGCATGGACTCTGAAGTGGTAGCTAATGAG
GCCATTCTCTATGCGCAGAGCCTCAAGCTTGCTGGCGACGGCAAGAACAT
TTGGGTTTTCGACATAGATGAAACCTCGCTATCTAATTTGCCATATTATG
CTAA
back to top