CF834330

Overview
NameCF834330
Unique NameCF834330
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length415
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1992 contig Csv1_Contig1992:1301..1713. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF834330 vs. ExPASy Swiss-Prot
Match: KSG5_ARATH (Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.115e-22
Identity = 48/60 (80.00%), Postives = 52/60 (86.67%), Query Frame = 3
Query:    3 ALEPCIHPFFYELRDPNPRLPNGRPFPPLFNFKPQELKGANTELLSKLIPEHARKQCPFL 182
            A+E  +HPFF ELRDPN RLPNGR  PPLFNFKPQELKGA+ ELLSKLIP+HARKQC FL
Sbjct:  349 AMEAIVHPFFDELRDPNTRLPNGRALPPLFNFKPQELKGASLELLSKLIPDHARKQCSFL 408          
BLAST of CF834330 vs. ExPASy Swiss-Prot
Match: KSG1_ARATH (Shaggy-related protein kinase alpha OS=Arabidopsis thaliana GN=ASK1 PE=2 SV=3)

HSP 1 Score: 100.138 bits (248), Expect = 3.588e-21
Identity = 44/61 (72.13%), Postives = 51/61 (83.61%), Query Frame = 3
Query:    3 ALEPCIHPFFYELRDPNPRLPNGRPFPPLFNFKPQELKGANTELLSKLIPEHARKQCPFLG 185
            AL+  +HPFF ELRDPN RLPNGR  PPLFNFKP ELKG   E+++KL+PEHARKQCP+LG
Sbjct:  344 ALDTLVHPFFDELRDPNARLPNGRFLPPLFNFKPHELKGVPLEMVAKLVPEHARKQCPWLG 404          
BLAST of CF834330 vs. ExPASy Swiss-Prot
Match: KSG3_ARATH (Shaggy-related protein kinase gamma OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.363e-20
Identity = 43/60 (71.67%), Postives = 50/60 (83.33%), Query Frame = 3
Query:    3 ALEPCIHPFFYELRDPNPRLPNGRPFPPLFNFKPQELKGANTELLSKLIPEHARKQCPFL 182
            AL+  +HPFF ELRDPN RLPNGR  PPLFNFKP ELKG   E+++KL+PEHARKQCP+L
Sbjct:  348 ALDSLVHPFFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWL 407          
BLAST of CF834330 vs. ExPASy Swiss-Prot
Match: MSK1_MEDSA (Glycogen synthase kinase-3 homolog MsK-1 OS=Medicago sativa GN=MSK-1 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.037e-20
Identity = 45/61 (73.77%), Postives = 47/61 (77.05%), Query Frame = 3
Query:    3 ALEPCIHPFFYELRDPNPRLPNGRPFPPLFNFKPQELKGANTELLSKLIPEHARKQCPFLG 185
            AL+   HPFF ELRDPN RLP GR  PPLFNFKP ELKG   E L KL+PEHARKQCPFLG
Sbjct:  350 ALDCLTHPFFDELRDPNARLPTGRFLPPLFNFKPHELKGVPVETLMKLVPEHARKQCPFLG 410          
BLAST of CF834330 vs. ExPASy Swiss-Prot
Match: KSG4_ARATH (Shaggy-related protein kinase delta OS=Arabidopsis thaliana GN=ASK4 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.180e-20
Identity = 43/60 (71.67%), Postives = 48/60 (80.00%), Query Frame = 3
Query:    3 ALEPCIHPFFYELRDPNPRLPNGRPFPPLFNFKPQELKGANTELLSKLIPEHARKQCPFL 182
            A+E CIHPFF ELRDPN RLPNGRP PPLFNFKPQEL G   E + +L+PEHARKQ  F+
Sbjct:  357 AVEACIHPFFDELRDPNARLPNGRPLPPLFNFKPQELSGIPPETVDRLVPEHARKQNHFM 416          
BLAST of CF834330 vs. ExPASy Swiss-Prot
Match: KSG10_ARATH (Shaggy-related protein kinase kappa OS=Arabidopsis thaliana GN=ASK10 PE=1 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 5.180e-20
Identity = 43/60 (71.67%), Postives = 49/60 (81.67%), Query Frame = 3
Query:    3 ALEPCIHPFFYELRDPNPRLPNGRPFPPLFNFKPQELKGANTELLSKLIPEHARKQCPFL 182
            ALE CIHP F ELRDPN RLPNGRP PPLFNFKPQEL G   E++++L+PEHARKQ  F+
Sbjct:  358 ALEACIHPLFDELRDPNTRLPNGRPLPPLFNFKPQELSGIPPEIVNRLVPEHARKQNLFM 417          
BLAST of CF834330 vs. ExPASy Swiss-Prot
Match: MSK1_TOBAC (Shaggy-related protein kinase NtK-1 OS=Nicotiana tabacum GN=NTK-1 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 5.728e-19
Identity = 44/61 (72.13%), Postives = 46/61 (75.41%), Query Frame = 3
Query:    3 ALEPCIHPFFYELRDPNPRLPNGRPFPPLFNFKPQELKGANTELLSKLIPEHARKQCPFLG 185
            ALE   H FF ELRDPN RLPNGR  PPLFNFK  ELKG + E L KL+PEHARKQCP LG
Sbjct:  348 ALEAVTHAFFDELRDPNTRLPNGRVLPPLFNFKAHELKGVSAENLLKLVPEHARKQCPSLG 408          
BLAST of CF834330 vs. ExPASy Swiss-Prot
Match: MSK2_MEDSA (Glycogen synthase kinase-3 homolog MsK-2 OS=Medicago sativa GN=MSK-2 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.843e-18
Identity = 41/57 (71.93%), Postives = 44/57 (77.19%), Query Frame = 3
Query:    3 ALEPCIHPFFYELRDPNPRLPNGRPFPPLFNFKPQELKGANTELLSKLIPEHARKQC 173
            ALE  +HPFF ELRDPN RLPNGR  PPLFNFK  ELKG   E+L KL+P HARKQC
Sbjct:  349 ALEALVHPFFDELRDPNTRLPNGRHLPPLFNFKANELKGVPAEMLVKLVPSHARKQC 405          
BLAST of CF834330 vs. ExPASy Swiss-Prot
Match: KSG6_ARATH (Shaggy-related protein kinase zeta OS=Arabidopsis thaliana GN=ASK6 PE=1 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 6.333e-18
Identity = 41/56 (73.21%), Postives = 47/56 (83.93%), Query Frame = 3
Query:    3 ALEPCIHPFFYELRDPNPRLPNGRPFPPLFNFKPQELKGANTELLSKLIPEHARKQ 170
            ALE C HPFF ELR+PN RLPNGRP PPLFNFK QEL GA+ EL+++LIPEH R+Q
Sbjct:  347 ALEACAHPFFNELREPNARLPNGRPLPPLFNFK-QELSGASPELINRLIPEHVRRQ 401          
BLAST of CF834330 vs. ExPASy Swiss-Prot
Match: KSG9_ARATH (Shaggy-related protein kinase iota OS=Arabidopsis thaliana GN=ASK9 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.080e-17
Identity = 41/56 (73.21%), Postives = 47/56 (83.93%), Query Frame = 3
Query:    3 ALEPCIHPFFYELRDPNPRLPNGRPFPPLFNFKPQELKGANTELLSKLIPEHARKQ 170
            ALE C HPFF ELR+PN RLPNGRP PPLFNFK QEL GA+ EL+++LIPEH R+Q
Sbjct:  345 ALEACAHPFFNELREPNARLPNGRPLPPLFNFK-QELGGASMELINRLIPEHVRRQ 399          
The following BLAST results are available for this feature:
BLAST of CF834330 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
KSG5_ARATH1.115e-2280.00Shaggy-related protein kinase epsilon OS=Arabidops... [more]
KSG1_ARATH3.588e-2172.13Shaggy-related protein kinase alpha OS=Arabidopsis... [more]
KSG3_ARATH1.363e-2071.67Shaggy-related protein kinase gamma OS=Arabidopsis... [more]
MSK1_MEDSA3.037e-2073.77Glycogen synthase kinase-3 homolog MsK-1 OS=Medica... [more]
KSG4_ARATH5.180e-2071.67Shaggy-related protein kinase delta OS=Arabidopsis... [more]
KSG10_ARATH5.180e-2071.67Shaggy-related protein kinase kappa OS=Arabidopsis... [more]
MSK1_TOBAC5.728e-1972.13Shaggy-related protein kinase NtK-1 OS=Nicotiana t... [more]
MSK2_MEDSA2.843e-1871.93Glycogen synthase kinase-3 homolog MsK-2 OS=Medica... [more]
KSG6_ARATH6.333e-1873.21Shaggy-related protein kinase zeta OS=Arabidopsis ... [more]
KSG9_ARATH1.080e-1773.21Shaggy-related protein kinase iota OS=Arabidopsis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05F14_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05F14, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834330 ID=CF834330; Name=CF834330; organism=Citrus sinensis; type=EST; length=415bp
CTGCTTTAGAACCCTGTATTCATCCATTTTTTTATGAACTTCGTGATCCT
AACCCACGACTCCCTAATGGGCGTCCCTTTCCTCCCCTTTTCAACTTTAA
ACCTCAAGAGCTGAAAGGGGCAAACACGGAGCTCTTATCAAAACTGATTC
CAGAACATGCACGAAAGCAATGTCCCTTCCTTGGTTTCTAGATTTCAACA
TGTAGTTGTTGGATATTAGAGTAAATTTATTGTACTAAATTTGGCTTTAT
GCTATCTGACGGATTAGGGATACATCCGTTGTTTATTCTCACCAAGAACT
GTTCCGACTGAAGTAAGCATGCAAAAGTGAGAGTGGCAGTTCAGTTAGAT
TATGCACTGATGAACAAAGTGAATATTTATGTGATGCATTTTGTTTAAAA
AAAATAAAAAAAAAA
back to top