CF834345

Overview
NameCF834345
Unique NameCF834345
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length593
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF834345 vs. ExPASy Swiss-Prot
Match: LSM2_MOUSE (U6 snRNA-associated Sm-like protein LSm2 OS=Mus musculus GN=Lsm2 PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 2.156e-32
Identity = 67/90 (74.44%), Postives = 76/90 (84.44%), Query Frame = 2
Query:   44 MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVDLLHDATRREA 313
            MLF+S+FK LVG++V VELKNDL+I GTLHSVDQYLNIKL +  V D +KYPHMLSV+NCFIRGSVVRYVQLP D VD  LL DA R+EA
Sbjct:    1 MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEA 90          
BLAST of CF834345 vs. ExPASy Swiss-Prot
Match: LSM2_HUMAN (U6 snRNA-associated Sm-like protein LSm2 OS=Homo sapiens GN=LSM2 PE=1 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 2.156e-32
Identity = 67/90 (74.44%), Postives = 76/90 (84.44%), Query Frame = 2
Query:   44 MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVDLLHDATRREA 313
            MLF+S+FK LVG++V VELKNDL+I GTLHSVDQYLNIKL +  V D +KYPHMLSV+NCFIRGSVVRYVQLP D VD  LL DA R+EA
Sbjct:    1 MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEA 90          
BLAST of CF834345 vs. ExPASy Swiss-Prot
Match: LSM2_DICDI (Probable U6 snRNA-associated Sm-like protein LSm2 OS=Dictyostelium discoideum GN=lsm2 PE=3 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.001e-29
Identity = 61/91 (67.03%), Postives = 78/91 (85.71%), Query Frame = 2
Query:   44 MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVDLLHDATRREAR 316
            MLFFS++K LVG+E+TVELKNDL+I G L SVDQ+LNIKL++ +V ++DKYP+M+SV+NCFIRGSVVRYV LP + VDV+ L D +R EAR
Sbjct:    1 MLFFSFYKSLVGKEITVELKNDLSITGLLQSVDQFLNIKLKDIKVNEEDKYPYMISVKNCFIRGSVVRYVHLPAEDVDVETLQDHSRLEAR 91          
BLAST of CF834345 vs. ExPASy Swiss-Prot
Match: LSM2_YEAST (U6 snRNA-associated Sm-like protein LSm2 OS=Saccharomyces cerevisiae GN=LSM2 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.768e-26
Identity = 59/89 (66.29%), Postives = 70/89 (78.65%), Query Frame = 2
Query:   44 MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVDLLHDATRRE 310
            MLFFS+FK LV +EV VELKND+ I+GTL SVDQ+LN+KL+N    D+ KYPH+ SVRN FIRGS VRYV L  + VD +LL DATRRE
Sbjct:    1 MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRRE 89          
BLAST of CF834345 vs. ExPASy Swiss-Prot
Match: LSM2_SCHPO (U6 snRNA-associated Sm-like protein LSm2 OS=Schizosaccharomyces pombe GN=lsm2 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 3.334e-25
Identity = 57/89 (64.04%), Postives = 69/89 (77.53%), Query Frame = 2
Query:   44 MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVDLLHDATRRE 310
            MLF+S+FK L+  EVTVELKND++IRG L SVDQ+LN+KLEN  VVD  KYPHM +V++ FIRGSVVRYV +    VD  LL DA RR+
Sbjct:    1 MLFYSFFKTLIDTEVTVELKNDMSIRGILKSVDQFLNVKLENISVVDASKYPHMAAVKDLFIRGSVVRYVHMSSAYVDTILLADACRRD 89          
BLAST of CF834345 vs. ExPASy Swiss-Prot
Match: LSM2_ENTBH (Probable U6 snRNA-associated Sm-like protein LSm2 OS=Enterocytozoon bieneusi (strain H348) GN=LSM2 PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.230e-11
Identity = 35/91 (38.46%), Postives = 59/91 (64.84%), Query Frame = 2
Query:   44 MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKY----PHMLSVRNCFIRGSVVRYVQLPPDGVDVDLLHDATR 304
            MLFF YFK  +  E+ V LKND++I G L +VD +LNIK+EN   +  +++      + +++ C IRGS ++ V+L  +G++  ++ +ATR
Sbjct:    1 MLFFEYFKSQLNNEIIVNLKNDISISGILKNVDPFLNIKIENVIAISTNEFIKINKSITNIQLCSIRGSAIKSVELKKNGLEEHMV-EATR 90          
The following BLAST results are available for this feature:
BLAST of CF834345 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
LSM2_MOUSE2.156e-3274.44U6 snRNA-associated Sm-like protein LSm2 OS=Mus mu... [more]
LSM2_HUMAN2.156e-3274.44U6 snRNA-associated Sm-like protein LSm2 OS=Homo s... [more]
LSM2_DICDI1.001e-2967.03Probable U6 snRNA-associated Sm-like protein LSm2 ... [more]
LSM2_YEAST1.768e-2666.29U6 snRNA-associated Sm-like protein LSm2 OS=Saccha... [more]
LSM2_SCHPO3.334e-2564.04U6 snRNA-associated Sm-like protein LSm2 OS=Schizo... [more]
LSM2_ENTBH1.230e-1138.46Probable U6 snRNA-associated Sm-like protein LSm2 ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05G02_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834345 ID=CF834345; Name=CF834345; organism=Citrus sinensis; type=EST; length=593bp
CGAAAGCAAAGCCCCTGAACCCTGTCCATTACGGCGACGAAAAATGCTGT
TCTTTTCATACTTCAAGGATTTGGTGGGCAGAGAAGTGACTGTTGAGTTG
AAGAACGATTTGGCAATAAGAGGGACTCTACATTCAGTTGATCAGTACCT
CAATATCAAGCTTGAGAATACGAGAGTGGTTGATCAAGACAAGTACCCTC
ACATGCTTTCAGTGAGGAACTGTTTCATCAGAGGATCAGTGGTTAGATAT
GTTCAACTGCCTCCTGATGGTGTTGATGTCGACCTGCTTCATGATGCCAC
AAGAAGAGAAGCTCGGGGTGGCTGAAGTTAGTTGTTTAAATCTTCAATGT
ACTTTTGTAGACATTGGTTTTTCTTCTTTTAGATGTAACTGTTTTTCTGT
TTAAACAAAGCCTAATTGACAGTATAAAGGCTGTATATCTGTTCCCTGTG
CTAATGTGGATGGAGTCCCTCCTATTAATTGGGAAAGTGTTGCTGGTTGT
GTGAACAATCTGTTTATCTGGGATTTTTCTGAATTCAATTATGGAAGCAT
TAGCAGTTGTCGCTTTTTATTTTGTTCAAAAAAAAAAAAAAAA
back to top