CF834449

Overview
NameCF834449
Unique NameCF834449
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length809
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13161 contig Csv1_Contig13161:195..1004. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF834449 vs. ExPASy Swiss-Prot
Match: FAD6C_BRANA (Omega-6 fatty acid desaturase, chloroplastic OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.573e-78
Identity = 124/145 (85.52%), Postives = 137/145 (94.48%), Query Frame = -1
Query:  375 IKYWLMPWLGYHFWMSTFTMVHHTAPHIPFKSPNEWNAAQAQLNGTVHCDYPKWIEILCHDINVHIPHHISPRIPSYNLRAAHKSIQQNWGKYLNEASWNWRLMKTIMTVCHIYDKEQNYVAFDQLAPKDSQPITFLKSVMPDHA 809
            +K+WLMPWLGYHFWMSTFTMVHHTAPHIPFK  +EWNAAQAQLNGTVHCDYP WIEILCHDINVHIPHHISPRIPSYNLRAAH+SIQ+NWGKY N A+WNWRLMKTIMTVCH+YDKE+NY+ FD+LAP++SQPITFLK  MPD+A
Sbjct:  298 VKFWLMPWLGYHFWMSTFTMVHHTAPHIPFKPADEWNAAQAQLNGTVHCDYPSWIEILCHDINVHIPHHISPRIPSYNLRAAHQSIQENWGKYTNLATWNWRLMKTIMTVCHVYDKEENYIPFDRLAPEESQPITFLKKAMPDYA 442          
BLAST of CF834449 vs. ExPASy Swiss-Prot
Match: FAD6C_ARATH (Omega-6 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD6 PE=1 SV=2)

HSP 1 Score: 289.271 bits (739), Expect = 1.739e-77
Identity = 122/144 (84.72%), Postives = 136/144 (94.44%), Query Frame = -1
Query:  378 IKYWLMPWLGYHFWMSTFTMVHHTAPHIPFKSPNEWNAAQAQLNGTVHCDYPKWIEILCHDINVHIPHHISPRIPSYNLRAAHKSIQQNWGKYLNEASWNWRLMKTIMTVCHIYDKEQNYVAFDQLAPKDSQPITFLKSVMPDH 809
            +K+WLMPWLGYHFWMSTFTMVHHTAPHIPFK  +EWNAAQAQLNGTVHCDYP WIEILCHDINVHIPHHISPRIPSYNLRAAH+SIQ+NWGKY N A+WNWRLMKTIMTVCH+YDKE+NY+ FD+LAP++SQPITFLK  MP++
Sbjct:  303 VKFWLMPWLGYHFWMSTFTMVHHTAPHIPFKPADEWNAAQAQLNGTVHCDYPSWIEILCHDINVHIPHHISPRIPSYNLRAAHESIQENWGKYTNLATWNWRLMKTIMTVCHVYDKEENYIPFDRLAPEESQPITFLKKAMPNY 446          
BLAST of CF834449 vs. ExPASy Swiss-Prot
Match: FAD6C_SPIOL (Omega-6 fatty acid desaturase, chloroplastic OS=Spinacia oleracea GN=FAD6 PE=1 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 1.022e-69
Identity = 111/145 (76.55%), Postives = 132/145 (91.03%), Query Frame = -1
Query:  375 IKYWLMPWLGYHFWMSTFTMVHHTAPHIPFKSPNEWNAAQAQLNGTVHCDYPKWIEILCHDINVHIPHHISPRIPSYNLRAAHKSIQQNWGKYLNEASWNWRLMKTIMTVCHIYDKEQNYVAFDQLAPKDSQPITFLKSVMPDHA 809
            IK+WLMPWLGYHFWMSTFT+VHHTAPHIPFKS  EWNAAQAQL+GTVHCDYP+WIEILCHDI+VHIPHHISP+IPSYNLRAA++S+ +NWG+YLN+   NWRLM+TIMT CHIYDK+ NYV+F++  P++SQPI+  K VMPD+A
Sbjct:  303 IKFWLMPWLGYHFWMSTFTIVHHTAPHIPFKSSKEWNAAQAQLSGTVHCDYPRWIEILCHDISVHIPHHISPKIPSYNLRAANQSLNENWGEYLNKPKSNWRLMRTIMTTCHIYDKDGNYVSFEKAVPEESQPISIPKRVMPDYA 447          
BLAST of CF834449 vs. ExPASy Swiss-Prot
Match: FAD6C_SOYBN (Omega-6 fatty acid desaturase, chloroplastic OS=Glycine max PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 5.249e-66
Identity = 107/128 (83.59%), Postives = 116/128 (90.62%), Query Frame = -1
Query:  426 IKYWLMPWLGYHFWMSTFTMVHHTAPHIPFKSPNEWNAAQAQLNGTVHCDYPKWIEILCHDINVHIPHHISPRIPSYNLRAAHKSIQQNWGKYLNEASWNWRLMKTIMTVCHIYDKEQNYVAFDQLAP 809
            IK+WLMPWLGYHFWMSTFTMVHHTAP+IPFK   EWN AQAQLNGTVHCDYPKWIEILCHDINVHIPHHISPRIPSYNLRAAHKS+Q+NWG+YLNEASWNWRLMKTIMTVC +YDKE++     +  P
Sbjct:  297 IKFWLMPWLGYHFWMSTFTMVHHTAPYIPFKYSEEWNRAQAQLNGTVHCDYPKWIEILCHDINVHIPHHISPRIPSYNLRAAHKSLQENWGQYLNEASWNWRLMKTIMTVCQVYDKEKSLCCLRRTCP 424          
BLAST of CF834449 vs. ExPASy Swiss-Prot
Match: DESA_SYNY3 (Fatty acid desaturase OS=Synechocystis sp. (strain PCC 6803) GN=desA PE=3 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.812e-50
Identity = 81/126 (64.29%), Postives = 101/126 (80.16%), Query Frame = -1
Query:  432 IKYWLMPWLGYHFWMSTFTMVHHTAPHIPFKSPNEWNAAQAQLNGTVHCDYPKWIEILCHDINVHIPHHISPRIPSYNLRAAHKSIQQNWGKYLNEASWNWRLMKTIMTVCHIYDKEQNYVAFDQL 809
            +K+WLMPWL YHFWMSTFT+VHHT P I F+   +W+AA+AQLNGTVHCDYP+W+E+LCHDINVHIPHH+S  IPSYNLR AH S+++NWG +L E ++NW+LM+ I   CH+YD E  Y  F  L
Sbjct:  223 VKFWLMPWLVYHFWMSTFTIVHHTIPEIRFRPAADWSAAEAQLNGTVHCDYPRWVEVLCHDINVHIPHHLSVAIPSYNLRLAHGSLKENWGPFLYERTFNWQLMQQISGQCHLYDPEHGYRTFGSL 348          
BLAST of CF834449 vs. ExPASy Swiss-Prot
Match: DESA_SPIPL (Fatty acid desaturase OS=Spirulina platensis GN=desA PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.180e-33
Identity = 58/109 (53.21%), Postives = 82/109 (75.23%), Query Frame = -1
Query:  486 IKYWLMPWLGYHFWMSTFTMVHHTAPHIPFKSPNEWNAAQAQLNGTVHCDYPKWIEILCHDINVHIPHHISPRIPSYNLRAAHKSIQQNWGKYL-NEASWNWRLMKTIM 809
            +K+W++PWL +HFWMSTFT++HHT   IPF+ P +W+ A++QL+GTVHC+Y +W E LCHDINVHIPHH++  IP YNLR      ++  G+YL  E  ++W LMK ++
Sbjct:  222 VKFWVIPWLVFHFWMSTFTLLHHTIADIPFREPEQWHEAESQLSGTVHCNYSRWGEFLCHDINVHIPHHVTTAIPWYNLRTPTPVYRKIGGEYLYPECDFSWGLMKQVV 330          
The following BLAST results are available for this feature:
BLAST of CF834449 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
FAD6C_BRANA1.573e-7885.52Omega-6 fatty acid desaturase, chloroplastic OS=Br... [more]
FAD6C_ARATH1.739e-7784.72Omega-6 fatty acid desaturase, chloroplastic OS=Ar... [more]
FAD6C_SPIOL1.022e-6976.55Omega-6 fatty acid desaturase, chloroplastic OS=Sp... [more]
FAD6C_SOYBN5.249e-6683.59Omega-6 fatty acid desaturase, chloroplastic OS=Gl... [more]
DESA_SYNY31.812e-5064.29Fatty acid desaturase OS=Synechocystis sp. (strain... [more]
DESA_SPIPL1.180e-3353.21Fatty acid desaturase OS=Spirulina platensis GN=de... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05I23_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05I23, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834449 ID=CF834449; Name=CF834449; organism=Citrus sinensis; type=EST; length=809bp
TTTTTTTTTTTTTTTTTAATATAAATCCCAATCATGTATATCCCATTGTA
AATATCAGTATAATATCTCTGCTATAATAGCAGTCGTTGTAAATATCTGT
GTAATACAGTAATCTAATGATTAATCAGTATTCAAAAAAAAAAAAAAAAG
AACAAGAGTCAAAGTCTAATAACTGGCAACAGTGAATTTCCAGGAACCCT
TCATTTCGACAATTTCTCCCCTACTCAATTGGAAATCTTAGGAAAGAGTA
GTTTCAACAACGTCGGCAACATCTAAGTAACGGGAACAGATACACCTAAT
TTGACCAAAAAAGTGAAGACTTATCGATAAGAAATAACTGAAAAGAGATG
GATTGAGGAAGTGGCAAAAATTCAAGCATGATCAGGCATCACACTTTTAA
GGAATGTAATTGGTTGAGAATCTTTGGGGGCAAGTTGGTCAAACGCCACA
TAATTTTGCTCCTTGTCATAGATGTGGCATACCGTCATTATTGTCTTCAT
CAAACGCCAATTCCATGAAGCCTCGTTCAAATACTTCCCCCAATTCTGTT
GGATAGATTTATGAGCTGCCCTCAAATTATAGCTTGGTATTCTCGGAGAG
ATATGATGGGGGATGTGGACATTGATGTCGTGGCAGAGAATCTCGATCCA
TTTAGGGTAATCACAATGAACTGTCCCATTAAGCTGGGCTTGGGCTGCAT
TCCACTCATTCGGAGATTTGAAAGGAATGTGAGGAGCTGTATGATGCACC
ATAGTGAAAGTACTCATCCAGAAGTGATAGCCCAACCATGGCATCAACCA
GTACTTTAT
back to top