CF834581

Overview
NameCF834581
Unique NameCF834581
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length540
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF834581 vs. ExPASy Swiss-Prot
Match: RL34_PEA (60S ribosomal protein L34 OS=Pisum sativum GN=RPL34 PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 8.600e-40
Identity = 82/95 (86.32%), Postives = 86/95 (90.53%), Query Frame = -3
Query:  236 MVQRVTYRARHRYATKSNQLRVVKTPGGKLVFQSSKKRASGLKCPVTGKRIQGILHLSPAEYKRCRLSRNRRTVIRAYGGVLSGGAVRERIIRAF 520
            MVQR+TYR RH YATKSNQ RVVKTPGGKLV+Q++KKRASG KCPVTGKRIQGI HL P EYKR RLSRNRRTV RAYGGVLSGGAVRERIIRAF
Sbjct:    1 MVQRLTYRRRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPTEYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF 95          
BLAST of CF834581 vs. ExPASy Swiss-Prot
Match: RL34_TOBAC (60S ribosomal protein L34 OS=Nicotiana tabacum GN=RPL34 PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.502e-39
Identity = 81/95 (85.26%), Postives = 85/95 (89.47%), Query Frame = -3
Query:  236 MVQRVTYRARHRYATKSNQLRVVKTPGGKLVFQSSKKRASGLKCPVTGKRIQGILHLSPAEYKRCRLSRNRRTVIRAYGGVLSGGAVRERIIRAF 520
            MVQR+TYR RH YATKSNQ RVVKTPGGKL++QS+KKRASG KCPVTGKRIQGI HL P EYKR RLSRNRRTV RAYGGVLSG AVRERIIRAF
Sbjct:    1 MVQRLTYRKRHSYATKSNQHRVVKTPGGKLIYQSTKKRASGPKCPVTGKRIQGIPHLRPTEYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF 95          
BLAST of CF834581 vs. ExPASy Swiss-Prot
Match: RL341_ARATH (60S ribosomal protein L34-1 OS=Arabidopsis thaliana GN=RPL34A PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 9.509e-39
Identity = 79/95 (83.16%), Postives = 86/95 (90.53%), Query Frame = -3
Query:  236 MVQRVTYRARHRYATKSNQLRVVKTPGGKLVFQSSKKRASGLKCPVTGKRIQGILHLSPAEYKRCRLSRNRRTVIRAYGGVLSGGAVRERIIRAF 520
            MVQR+ YR+RH YATKSNQ R+VKTPGGKLV+Q++KKRASG KCPVTGKRIQGI HL P+EYKR RLSRNRRTV RAYGGVLSG AVRERIIRAF
Sbjct:    1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPSEYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF 95          
BLAST of CF834581 vs. ExPASy Swiss-Prot
Match: RL342_ARATH (60S ribosomal protein L34-2 OS=Arabidopsis thaliana GN=RPL34B PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 3.613e-38
Identity = 78/95 (82.11%), Postives = 84/95 (88.42%), Query Frame = -3
Query:  236 MVQRVTYRARHRYATKSNQLRVVKTPGGKLVFQSSKKRASGLKCPVTGKRIQGILHLSPAEYKRCRLSRNRRTVIRAYGGVLSGGAVRERIIRAF 520
            MVQR+ YR+RH YATKSNQ R+VKTPGGKL +Q++KKRASG KCPVTGKRIQGI HL P EYKR RLSRNRRTV RAYGGVLSG AVRERIIRAF
Sbjct:    1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPTEYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF 95          
BLAST of CF834581 vs. ExPASy Swiss-Prot
Match: RL343_ARATH (60S ribosomal protein L34-3 OS=Arabidopsis thaliana GN=RPL34C PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.162e-36
Identity = 75/95 (78.95%), Postives = 83/95 (87.37%), Query Frame = -3
Query:  236 MVQRVTYRARHRYATKSNQLRVVKTPGGKLVFQSSKKRASGLKCPVTGKRIQGILHLSPAEYKRCRLSRNRRTVIRAYGGVLSGGAVRERIIRAF 520
            MVQR+ YR+RH YATKSNQ R+VKTPGGKL +Q++ KRASG KCPVTGKRIQGI HL PAEYKR RL+RN RTV RAYGGVLSG AVRERI+RAF
Sbjct:    1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTNKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLARNERTVNRAYGGVLSGVAVRERIVRAF 95          
BLAST of CF834581 vs. ExPASy Swiss-Prot
Match: RL34A_SCHPO (60S ribosomal protein L34-A OS=Schizosaccharomyces pombe GN=rpl34a PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 5.425e-18
Identity = 48/95 (50.53%), Postives = 63/95 (66.32%), Query Frame = -3
Query:  236 MVQRVTYRARHRYATKSNQLRVVKTPGGKLVFQSSKKRASGLKCPVTGKRIQGILHLSPAEYKRCRLSRNRRTVIRAYGGVLSGGAVRERIIRAF 520
            M QRVTYR R  Y T+SN+ R++KTPG  + +   KK  +  +C  TG  +QGI  L P E+   RLS N++TV RAYGG LS  AV++RI+RAF
Sbjct:    1 MAQRVTYRRRLAYNTRSNRTRIIKTPGNNIRYLHIKKLGTIPRCGDTGVPLQGIPALRPREF--ARLSHNKKTVQRAYGGCLSANAVKDRIVRAF 93          
BLAST of CF834581 vs. ExPASy Swiss-Prot
Match: RL34B_SCHPO (60S ribosomal protein L34-B OS=Schizosaccharomyces pombe GN=rpl34b PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.516e-17
Identity = 47/95 (49.47%), Postives = 62/95 (65.26%), Query Frame = -3
Query:  236 MVQRVTYRARHRYATKSNQLRVVKTPGGKLVFQSSKKRASGLKCPVTGKRIQGILHLSPAEYKRCRLSRNRRTVIRAYGGVLSGGAVRERIIRAF 520
            M QRVTYR R  Y T+SN+ R++KTPG  + +   KK  +  +C  TG  +QGI  L P E+   RLS N++ V RAYGG LS  AV++RI+RAF
Sbjct:    1 MAQRVTYRRRLAYNTRSNKTRIIKTPGNNIRYLHIKKLGTIPRCGDTGVPLQGIPALRPREF--ARLSHNQKKVQRAYGGCLSANAVKDRIVRAF 93          
BLAST of CF834581 vs. ExPASy Swiss-Prot
Match: RL34A_YEAST (60S ribosomal protein L34-A OS=Saccharomyces cerevisiae GN=RPL34A PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 7.833e-17
Identity = 48/95 (50.53%), Postives = 61/95 (64.21%), Query Frame = -3
Query:  236 MVQRVTYRARHRYATKSNQLRVVKTPGGKLVFQSSKKRASGLKCPVTGKRIQGILHLSPAEYKRCRLSRNRRTVIRAYGGVLSGGAVRERIIRAF 520
            M QRVT+R R+ Y T+SN+++VVKTPGG L  Q  KK A+  KC   G  +QGI  L P +Y    +S+  +TV RAYGG      V+ERIIRAF
Sbjct:    1 MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPRQY--ATVSKTHKTVSRAYGGSRCANCVKERIIRAF 93          
BLAST of CF834581 vs. ExPASy Swiss-Prot
Match: RL34B_YEAST (60S ribosomal protein L34-B OS=Saccharomyces cerevisiae GN=RPL34B PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.023e-16
Identity = 47/95 (49.47%), Postives = 61/95 (64.21%), Query Frame = -3
Query:  236 MVQRVTYRARHRYATKSNQLRVVKTPGGKLVFQSSKKRASGLKCPVTGKRIQGILHLSPAEYKRCRLSRNRRTVIRAYGGVLSGGAVRERIIRAF 520
            M QRVT+R R+ Y T+SN+++VVKTPGG L  Q  KK A+  KC   G  +QGI  L P +Y    +S+  +TV RAYGG      V+ERI+RAF
Sbjct:    1 MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPRQY--ATVSKTHKTVSRAYGGSRCANCVKERIVRAF 93          
BLAST of CF834581 vs. ExPASy Swiss-Prot
Match: RL34_DICDI (60S ribosomal protein L34 OS=Dictyostelium discoideum GN=rpl34 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.977e-16
Identity = 47/95 (49.47%), Postives = 58/95 (61.05%), Query Frame = -3
Query:  236 MVQRVTYRARHRYATKSNQLRVVKTPGGKLVFQSSKKRASGLKCPVTGKRIQGILHLSPAEYKRCRLSRNRRTVIRAYGGVLSGGAVRERIIRAF 520
            MVQR+TYR R  Y T SN  ++VKTPGG+LV+Q   K     +C   G  + GI  L P +YK   L ++RRTV RAYGG      VR RI+RAF
Sbjct:    1 MVQRLTYRRRLSYRTTSNATKIVKTPGGRLVYQYIGKTGKVPRCGECGVNLAGIPALRPYQYK--NLPKSRRTVSRAYGGSKCAKCVRNRIVRAF 93          
The following BLAST results are available for this feature:
BLAST of CF834581 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
RL34_PEA8.600e-4086.3260S ribosomal protein L34 OS=Pisum sativum GN=RPL3... [more]
RL34_TOBAC2.502e-3985.2660S ribosomal protein L34 OS=Nicotiana tabacum GN=... [more]
RL341_ARATH9.509e-3983.1660S ribosomal protein L34-1 OS=Arabidopsis thalian... [more]
RL342_ARATH3.613e-3882.1160S ribosomal protein L34-2 OS=Arabidopsis thalian... [more]
RL343_ARATH1.162e-3678.9560S ribosomal protein L34-3 OS=Arabidopsis thalian... [more]
RL34A_SCHPO5.425e-1850.5360S ribosomal protein L34-A OS=Schizosaccharomyces... [more]
RL34B_SCHPO3.516e-1749.4760S ribosomal protein L34-B OS=Schizosaccharomyces... [more]
RL34A_YEAST7.833e-1750.5360S ribosomal protein L34-A OS=Saccharomyces cerev... [more]
RL34B_YEAST1.023e-1649.4760S ribosomal protein L34-B OS=Saccharomyces cerev... [more]
RL34_DICDI2.977e-1649.4760S ribosomal protein L34 OS=Dictyostelium discoid... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05M12_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05M12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834581 ID=CF834581; Name=CF834581; organism=Citrus sinensis; type=EST; length=540bp
TTTTTTTTTTTTTTTTTGGGNAAAGAAACATCCAAGCAAAAACCCCCTTT
TCATTCACCTTTAAATAGAACGGCACAAAATGCCATCGCTAATAATTCCT
ACCAGTCAAAATTTCCTAAGAAAATTAAAACTGCAAAACAAAAGCTGCTG
TCTCAATTTAACTCTTAGATGCCAGCTTTTCTTTGGCCTTCTGAATCTTC
AGCACTTTCTTGACAATCTTCTGCTCCTCCACCAAAAAGGCCCGGATAAT
CCTCTCCCTGACAGCACCTCCAGATAATACACCCCCATAGGCACGGATGA
CCGTCCTCCTATTTCGAGATAGCCTACACCTCTTGTACTCAGCAGGGCTC
AAGTGAAGAATTCCTTGGATCCTTTTTCCAGTGACAGGACACTTAAGCCC
ACTTGCTCTCTTCTTGGAGCTCTGGAAAACCAACTTCCCCCCGGGGGTTT
TGACGACGCGGAGCTGGTTGGACTTGGTGGCATACCTGTGGCGCGCGCGG
TATGTGACACGTTGAACCATTTTCGCTCGCTTTCGAGGAG
back to top