CF834602

Overview
NameCF834602
Unique NameCF834602
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length702
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF834602 vs. ExPASy Swiss-Prot
Match: RL172_ARATH (60S ribosomal protein L17-2 OS=Arabidopsis thaliana GN=RPL17B PE=2 SV=2)

HSP 1 Score: 248.825 bits (634), Expect = 2.047e-65
Identity = 126/154 (81.82%), Postives = 134/154 (87.01%), Query Frame = -3
Query:  239 SDIRVHFKNTRETAHAIRKLPLMKAKRYLEDVMAHKQAIPFTRFCGGVGRAAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNGEVKGLDVDALYICHIQVNQAQKQRRRTYRAHGRINPYMSSPFHIELTLSXXXXXXXXXXETQLATSKSKK 700
            SD+RVHFKNTRETAHAIRKLPL+KAKRYLEDV+AHKQAIPFTRFC GVGR AQAKNRH NGQGRWP KSA+F+LDLLKNAESN EVKGLDVDAL+I HIQVNQA KQRRRTYRAHGRINPYMS+P HIEL LS          ETQLA +KSKK
Sbjct:   20 SDLRVHFKNTRETAHAIRKLPLIKAKRYLEDVIAHKQAIPFTRFCRGVGRTAQAKNRHSNGQGRWPAKSAQFVLDLLKNAESNAEVKGLDVDALFISHIQVNQAAKQRRRTYRAHGRINPYMSNPCHIELILSEKEEPVKKEPETQLA-AKSKK 172          
BLAST of CF834602 vs. ExPASy Swiss-Prot
Match: RL171_ARATH (60S ribosomal protein L17-1 OS=Arabidopsis thaliana GN=RPL17A PE=1 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.016e-64
Identity = 125/154 (81.17%), Postives = 133/154 (86.36%), Query Frame = -3
Query:  239 SDIRVHFKNTRETAHAIRKLPLMKAKRYLEDVMAHKQAIPFTRFCGGVGRAAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNGEVKGLDVDALYICHIQVNQAQKQRRRTYRAHGRINPYMSSPFHIELTLSXXXXXXXXXXETQLATSKSKK 700
            +D+RVHFKNTRETAHAIRKLPL KAKRYLEDV+AHKQAIPFTRFC GVGR AQAKNRH NGQGRWP KSA+F+LDLLKNAESN EVKGLDVDAL+I HIQVNQA KQRRRTYRAHGRINPYMS+P HIEL LS          ETQLA +KSKK
Sbjct:   20 ADLRVHFKNTRETAHAIRKLPLNKAKRYLEDVIAHKQAIPFTRFCRGVGRTAQAKNRHSNGQGRWPAKSAQFVLDLLKNAESNAEVKGLDVDALFISHIQVNQAAKQRRRTYRAHGRINPYMSNPCHIELILSEKEEPVKKEPETQLA-AKSKK 172          
BLAST of CF834602 vs. ExPASy Swiss-Prot
Match: RL17_MAIZE (60S ribosomal protein L17 OS=Zea mays GN=RPL17 PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 4.719e-62
Identity = 114/132 (86.36%), Postives = 122/132 (92.42%), Query Frame = -3
Query:  302 DIRVHFKNTRETAHAIRKLPLMKAKRYLEDVMAHKQAIPFTRFCGGVGRAAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNGEVKGLDVDALYICHIQVNQAQKQRRRTYRAHGRINPYMSSPFHIELTLS 697
            D+RVHFKNTRETA A+RKLPL KAKRYLEDV+AHKQAIPF R+CGGVGR AQAK+RH NGQGRWPVKSA+FILDLLKNAESN +VKGLDVD LY+ HIQVNQAQKQRRRTYRAHGRINPYMSSP HIEL LS
Sbjct:   21 DLRVHFKNTRETAFALRKLPLTKAKRYLEDVIAHKQAIPFRRYCGGVGRTAQAKSRHSNGQGRWPVKSARFILDLLKNAESNADVKGLDVDNLYVSHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELILS 152          
BLAST of CF834602 vs. ExPASy Swiss-Prot
Match: RL171_HORVU (60S ribosomal protein L17-1 OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.373e-61
Identity = 113/132 (85.61%), Postives = 120/132 (90.91%), Query Frame = -3
Query:  302 DIRVHFKNTRETAHAIRKLPLMKAKRYLEDVMAHKQAIPFTRFCGGVGRAAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNGEVKGLDVDALYICHIQVNQAQKQRRRTYRAHGRINPYMSSPFHIELTLS 697
            D+RVHFKNTRETA A+RK+PL KAKRYLEDV+AHKQAIPF R+C GVGR AQ KNR PNGQGRWP KSAKF+LDLLKNAESN EVKGLDVDALYI HIQVNQAQKQRRRTYRAHGRINPYMS+P HIEL LS
Sbjct:   21 DLRVHFKNTRETAFALRKMPLNKAKRYLEDVLAHKQAIPFRRYCRGVGRTAQVKNRQPNGQGRWPAKSAKFVLDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSNPCHIELILS 152          
BLAST of CF834602 vs. ExPASy Swiss-Prot
Match: RL172_HORVU (60S ribosomal protein L17-2 OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 5.768e-60
Identity = 110/132 (83.33%), Postives = 119/132 (90.15%), Query Frame = -3
Query:  302 DIRVHFKNTRETAHAIRKLPLMKAKRYLEDVMAHKQAIPFTRFCGGVGRAAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNGEVKGLDVDALYICHIQVNQAQKQRRRTYRAHGRINPYMSSPFHIELTLS 697
            D+RVHFKNTRETA A+R++PL KAKRYLEDV+AHKQAIPF R+C GVGR AQ KNR PNGQGRWP KSA+F+LDLLKNAESN EVKGLDVD LYI HIQVNQAQKQRRRTYRAHGRINPYMS+P HIEL LS
Sbjct:   21 DLRVHFKNTRETAFALRRMPLGKAKRYLEDVLAHKQAIPFRRYCRGVGRTAQVKNRQPNGQGRWPAKSAQFVLDLLKNAESNAEVKGLDVDNLYISHIQVNQAQKQRRRTYRAHGRINPYMSNPCHIELILS 152          
BLAST of CF834602 vs. ExPASy Swiss-Prot
Match: RL17_PODCA (60S ribosomal protein L17 OS=Podocoryne carnea GN=RPL17 PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.474e-47
Identity = 96/133 (72.18%), Postives = 110/133 (82.71%), Query Frame = -3
Query:  302 SDIRVHFKNTRETAHAIRKLPLMKAKRYLEDVMAHKQAIPFTRFCGGVGRAAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNGEVKGLDVDALYICHIQVNQAQKQRRRTYRAHGRINPYMSSPFHIELTLS 700
            S +RVHFKNTRETA AI+K+ + KA RYL+DV+A KQ IPF RFCGGVGR AQAK    + QGRWPVKSA+F+L LLKNAESN +VKGLDVD+L I HIQVN+A   RRRTYRAHGRINPYMSSP HIE+ +S
Sbjct:   20 SYLRVHFKNTRETAQAIKKMHIRKAYRYLKDVIAKKQIIPFRRFCGGVGRKAQAK-AFKHTQGRWPVKSAEFLLGLLKNAESNADVKGLDVDSLVIDHIQVNRAPYMRRRTYRAHGRINPYMSSPCHIEMIVS 151          
BLAST of CF834602 vs. ExPASy Swiss-Prot
Match: RL17_SUBDO (60S ribosomal protein L17 OS=Suberites domuncula GN=RPL17 PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.992e-44
Identity = 91/132 (68.94%), Postives = 104/132 (78.79%), Query Frame = -3
Query:  305 DIRVHFKNTRETAHAIRKLPLMKAKRYLEDVMAHKQAIPFTRFCGGVGRAAQAKN-RHPNGQGRWPVKSAKFILDLLKNAESNGEVKGLDVDALYICHIQVNQAQKQRRRTYRAHGRINPYMSSPFHIELTL 697
            D+RVHFKNTRETA AI+ + L KA RYL DV+  KQ IPF RF GGVGR AQAKN + P  QGRWP KSA+F++ LL+NAESN EVK L+ DAL I HIQVN+A   RRRTYRAHGRINPYM+SP HIE+ L
Sbjct:   21 DLRVHFKNTRETAQAIKGMHLKKALRYLNDVIEKKQIIPFRRFSGGVGRKAQAKNFKTPGSQGRWPKKSAQFLIQLLRNAESNAEVKMLNTDALVIDHIQVNRAAHLRRRTYRAHGRINPYMTSPCHIEMFL 152          
BLAST of CF834602 vs. ExPASy Swiss-Prot
Match: RL17_HUMAN (60S ribosomal protein L17 OS=Homo sapiens GN=RPL17 PE=1 SV=3)

HSP 1 Score: 177.178 bits (448), Expect = 7.569e-44
Identity = 89/133 (66.92%), Postives = 106/133 (79.70%), Query Frame = -3
Query:  302 SDIRVHFKNTRETAHAIRKLPLMKAKRYLEDVMAHKQAIPFTRFCGGVGRAAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNGEVKGLDVDALYICHIQVNQAQKQRRRTYRAHGRINPYMSSPFHIELTLS 700
            S++RVHFKNTRETA AI+ + + KA +YL+DV   KQ +PF R+ GGVGR AQAK      QGRWP KSA+F+L +LKNAESN E+KGLDVD+L I HIQVN+A K RRRTYRAHGRINPYMSSP HIE+ L+
Sbjct:   20 SNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRCAQAKQWGWT-QGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMILT 151          
BLAST of CF834602 vs. ExPASy Swiss-Prot
Match: RL17_FELCA (60S ribosomal protein L17 OS=Felis catus GN=RPL17 PE=2 SV=3)

HSP 1 Score: 177.178 bits (448), Expect = 7.569e-44
Identity = 89/133 (66.92%), Postives = 106/133 (79.70%), Query Frame = -3
Query:  302 SDIRVHFKNTRETAHAIRKLPLMKAKRYLEDVMAHKQAIPFTRFCGGVGRAAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNGEVKGLDVDALYICHIQVNQAQKQRRRTYRAHGRINPYMSSPFHIELTLS 700
            S++RVHFKNTRETA AI+ + + KA +YL+DV   KQ +PF R+ GGVGR AQAK      QGRWP KSA+F+L +LKNAESN E+KGLDVD+L I HIQVN+A K RRRTYRAHGRINPYMSSP HIE+ L+
Sbjct:   20 SNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRCAQAKQWGWT-QGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMILT 151          
BLAST of CF834602 vs. ExPASy Swiss-Prot
Match: RL17_RAT (60S ribosomal protein L17 OS=Rattus norvegicus GN=Rpl17 PE=2 SV=3)

HSP 1 Score: 176.792 bits (447), Expect = 9.885e-44
Identity = 89/133 (66.92%), Postives = 106/133 (79.70%), Query Frame = -3
Query:  302 SDIRVHFKNTRETAHAIRKLPLMKAKRYLEDVMAHKQAIPFTRFCGGVGRAAQAKNRHPNGQGRWPVKSAKFILDLLKNAESNGEVKGLDVDALYICHIQVNQAQKQRRRTYRAHGRINPYMSSPFHIELTLS 700
            S++RVHFKNTRETA AI+ + + KA +YL+DV   KQ +PF R+ GGVGR AQAK      QGRWP KSA+F+L +LKNAESN E+KGLDVD+L I HIQVN+A K RRRTYRAHGRINPYMSSP HIE+ L+
Sbjct:   20 SNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLKKQCVPFRRYNGGVGRCAQAKQWGWT-QGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMILT 151          
The following BLAST results are available for this feature:
BLAST of CF834602 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
RL172_ARATH2.047e-6581.8260S ribosomal protein L17-2 OS=Arabidopsis thalian... [more]
RL171_ARATH1.016e-6481.1760S ribosomal protein L17-1 OS=Arabidopsis thalian... [more]
RL17_MAIZE4.719e-6286.3660S ribosomal protein L17 OS=Zea mays GN=RPL17 PE=... [more]
RL171_HORVU1.373e-6185.6160S ribosomal protein L17-1 OS=Hordeum vulgare PE=... [more]
RL172_HORVU5.768e-6083.3360S ribosomal protein L17-2 OS=Hordeum vulgare PE=... [more]
RL17_PODCA1.474e-4772.1860S ribosomal protein L17 OS=Podocoryne carnea GN=... [more]
RL17_SUBDO1.992e-4468.9460S ribosomal protein L17 OS=Suberites domuncula G... [more]
RL17_HUMAN7.569e-4466.9260S ribosomal protein L17 OS=Homo sapiens GN=RPL17... [more]
RL17_FELCA7.569e-4466.9260S ribosomal protein L17 OS=Felis catus GN=RPL17 ... [more]
RL17_RAT9.885e-4466.9260S ribosomal protein L17 OS=Rattus norvegicus GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05M24_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05M24, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834602 ID=CF834602; Name=CF834602; organism=Citrus sinensis; type=EST; length=702bp
TTTTTTTTTTTTTTTTTAGGCTTGAAAAGCCTTTAATTTTCATAAAGCCC
TTTAAGAATGACTGAGGATTCTAACAAAACAGTAAACTGGCCTTAATATG
AAATAAACAAAATATGATGTCTGATTTGACTAAATAACATCTCAGTCACT
ATTAAAGGTAAAAAAACTCACTTCATCAAGAACACAAAATAGAAAATCAA
TGCACTCTCCAATTGCTATGCTAAACCTCAGACAATTACTTCTTTGATTT
GCTAGTTGCCAACTGGGTCTCAGGCTCTTTCTTTACTGGCTCTTCCTTTT
CAGATAAGGTCAACTCAATATGGAAGGGAGAGGACATGTAAGGATTAATT
CTTCCATGAGCACGGTATGTGCGGCGCCTTTGCTTTTGTGCCTGGTTGAC
TTGGATGTGACAAATGTAGAGTGCATCAACATCTAAACCTTTCACCTCAC
CATTACTCTCAGCATTCTTGAGCAAGTCAAGAATGAACTTTGCTGATTTG
ACAGGCCATCGTCCCTGTCCATTTGGATGCCTATTCTTTGCCTGAGCAGC
ACGTCCAACACCACCGCAGAATCGTGTGAAGGGAATGGCCTGTTTATGGG
CCATAACATCCTCCAAATACCTCTTAGCCTTCATCAAAGGCAATTTCCTG
ATGGCATGGGCAGTTTCTCTCGTGTTCTTAAAATGAACCCTGATATCAGA
GC
back to top