CF834604

Overview
NameCF834604
Unique NameCF834604
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length370
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF834604 vs. ExPASy Swiss-Prot
Match: RS28_MAIZE (40S ribosomal protein S28 OS=Zea mays GN=RPS28 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.482e-14
Identity = 37/40 (92.50%), Postives = 38/40 (95.00%), Query Frame = -2
Query:  250 EVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 369
            +VMGRTGSRGQVTQVRVKFLDDQNR IMRNVKGPV EGDI
Sbjct:   12 KVMGRTGSRGQVTQVRVKFLDDQNRLIMRNVKGPVCEGDI 51          
BLAST of CF834604 vs. ExPASy Swiss-Prot
Match: RS282_ARATH (40S ribosomal protein S28-2 OS=Arabidopsis thaliana GN=RPS28C PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.143e-11
Identity = 34/40 (85.00%), Postives = 37/40 (92.50%), Query Frame = -2
Query:  250 EVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 369
            +VMGRTGSRGQVTQVRVKF  D +RFIMRNVKGPVREGD+
Sbjct:   12 KVMGRTGSRGQVTQVRVKF-TDSDRFIMRNVKGPVREGDV 50          
BLAST of CF834604 vs. ExPASy Swiss-Prot
Match: RS28_ICTPU (40S ribosomal protein S28 OS=Ictalurus punctatus GN=rps28 PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.950e-11
Identity = 30/40 (75.00%), Postives = 37/40 (92.50%), Query Frame = -2
Query:  250 EVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 369
            +V+GRTGS+GQ TQVRV+F+DD NR I+RNVKGPVREGD+
Sbjct:   16 KVLGRTGSQGQCTQVRVEFMDDSNRSIIRNVKGPVREGDV 55          
BLAST of CF834604 vs. ExPASy Swiss-Prot
Match: RS28_DANRE (40S ribosomal protein S28 OS=Danio rerio GN=rps28 PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.950e-11
Identity = 30/40 (75.00%), Postives = 37/40 (92.50%), Query Frame = -2
Query:  250 EVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 369
            +V+GRTGS+GQ TQVRV+F+DD NR I+RNVKGPVREGD+
Sbjct:   16 KVLGRTGSQGQCTQVRVEFMDDSNRSIIRNVKGPVREGDV 55          
BLAST of CF834604 vs. ExPASy Swiss-Prot
Match: RS281_ARATH (40S ribosomal protein S28-1 OS=Arabidopsis thaliana GN=RPS28A PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.950e-11
Identity = 34/40 (85.00%), Postives = 37/40 (92.50%), Query Frame = -2
Query:  250 EVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 369
            +VMGRTGSRGQVTQVRVKF  D +R+IMRNVKGPVREGDI
Sbjct:   12 KVMGRTGSRGQVTQVRVKF-TDSDRYIMRNVKGPVREGDI 50          
BLAST of CF834604 vs. ExPASy Swiss-Prot
Match: RS28_RAT (40S ribosomal protein S28 OS=Rattus norvegicus GN=Rps28 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.676e-11
Identity = 29/40 (72.50%), Postives = 37/40 (92.50%), Query Frame = -2
Query:  250 EVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 369
            +V+GRTGS+GQ TQVRV+F+DD +R I+RNVKGPVREGD+
Sbjct:   16 KVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDV 55          
BLAST of CF834604 vs. ExPASy Swiss-Prot
Match: RS28_PIG (40S ribosomal protein S28 OS=Sus scrofa GN=RPS28 PE=3 SV=2)

HSP 1 Score: 65.4698 bits (158), Expect = 9.676e-11
Identity = 29/40 (72.50%), Postives = 37/40 (92.50%), Query Frame = -2
Query:  250 EVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 369
            +V+GRTGS+GQ TQVRV+F+DD +R I+RNVKGPVREGD+
Sbjct:   16 KVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDV 55          
BLAST of CF834604 vs. ExPASy Swiss-Prot
Match: RS28_NEUCR (40S ribosomal protein S28 OS=Neurospora crassa GN=rps-28 PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.676e-11
Identity = 31/39 (79.49%), Postives = 35/39 (89.74%), Query Frame = -2
Query:  250 VMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 366
            V+GRTGSRG VTQVRV+F+DDQ R I+RNVKGPVRE DI
Sbjct:   16 VLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54          
BLAST of CF834604 vs. ExPASy Swiss-Prot
Match: RS28_MOUSE (40S ribosomal protein S28 OS=Mus musculus GN=Rps28 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.676e-11
Identity = 29/40 (72.50%), Postives = 37/40 (92.50%), Query Frame = -2
Query:  250 EVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 369
            +V+GRTGS+GQ TQVRV+F+DD +R I+RNVKGPVREGD+
Sbjct:   16 KVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDV 55          
BLAST of CF834604 vs. ExPASy Swiss-Prot
Match: RS28_KLUMA (40S ribosomal protein S28 OS=Kluyveromyces marxianus GN=RPS28 PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.676e-11
Identity = 31/40 (77.50%), Postives = 36/40 (90.00%), Query Frame = -2
Query:  250 EVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 369
            +V+GRTGSRG VTQVRV+FL+D  R I+RNVKGPVREGDI
Sbjct:   14 KVLGRTGSRGGVTQVRVEFLEDTTRTIVRNVKGPVREGDI 53          
The following BLAST results are available for this feature:
BLAST of CF834604 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
RS28_MAIZE5.482e-1492.5040S ribosomal protein S28 OS=Zea mays GN=RPS28 PE=... [more]
RS282_ARATH1.143e-1185.0040S ribosomal protein S28-2 OS=Arabidopsis thalian... [more]
RS28_ICTPU1.950e-1175.0040S ribosomal protein S28 OS=Ictalurus punctatus G... [more]
RS28_DANRE1.950e-1175.0040S ribosomal protein S28 OS=Danio rerio GN=rps28 ... [more]
RS281_ARATH1.950e-1185.0040S ribosomal protein S28-1 OS=Arabidopsis thalian... [more]
RS28_RAT9.676e-1172.5040S ribosomal protein S28 OS=Rattus norvegicus GN=... [more]
RS28_PIG9.676e-1172.5040S ribosomal protein S28 OS=Sus scrofa GN=RPS28 P... [more]
RS28_NEUCR9.676e-1179.4940S ribosomal protein S28 OS=Neurospora crassa GN=... [more]
RS28_MOUSE9.676e-1172.5040S ribosomal protein S28 OS=Mus musculus GN=Rps28... [more]
RS28_KLUMA9.676e-1177.5040S ribosomal protein S28 OS=Kluyveromyces marxian... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05N01_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05N01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834604 ID=CF834604; Name=CF834604; organism=Citrus sinensis; type=EST; length=370bp
GCAATTTAACTCCATTTCAAAGAGAACCATATTAAACATCCCAAAACATA
TAATTCATGGCTCAAAACCCAGTCTTAATATGAAAACCTTCAAAATAAGT
TGTGAAACTCATAACATTGCCAATCACTAGCCTACTAAAAACAACAGTAA
TGAACCCTAGTTTCCAACAAAAAGTTTGAGATAGTATGACCAGAGATGGA
CTCTTCAACGGAGCCTCCTAGCTTCTCTCTCAGACTCGAGCAAAGTGAGG
ATATCACCTTCTCTAACGGGTCCCTTCACATTCCTCATGATGAATCGGTT
CTGATCATCTAAAAACTTGACTCTCACTTGAGTAACCTGTCCTCTTGAAC
CAGTGCGGCCCATGACTTCC
back to top