CF834605

Overview
NameCF834605
Unique NameCF834605
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length391
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF834605 vs. ExPASy Swiss-Prot
Match: RS28_MAIZE (40S ribosomal protein S28 OS=Zea mays GN=RPS28 PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.591e-13
Identity = 36/39 (92.31%), Postives = 36/39 (92.31%), Query Frame = 3
Query:    6 VMGRTGSRGQVTPVRVKFLDDQNRFIMRNVKGPVREGDI 122
            VMGRTGSRGQVT VRVKFLDDQNR IMRNVKGPV EGDI
Sbjct:   13 VMGRTGSRGQVTQVRVKFLDDQNRLIMRNVKGPVCEGDI 51          
BLAST of CF834605 vs. ExPASy Swiss-Prot
Match: RS282_ARATH (40S ribosomal protein S28-2 OS=Arabidopsis thaliana GN=RPS28C PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.488e-11
Identity = 33/39 (84.62%), Postives = 35/39 (89.74%), Query Frame = 3
Query:    6 VMGRTGSRGQVTPVRVKFLDDQNRFIMRNVKGPVREGDI 122
            VMGRTGSRGQVT VRVKF D  +RFIMRNVKGPVREGD+
Sbjct:   13 VMGRTGSRGQVTQVRVKFTDS-DRFIMRNVKGPVREGDV 50          
The following BLAST results are available for this feature:
BLAST of CF834605 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
RS28_MAIZE3.591e-1392.3140S ribosomal protein S28 OS=Zea mays GN=RPS28 PE=... [more]
RS282_ARATH7.488e-1184.6240S ribosomal protein S28-2 OS=Arabidopsis thalian... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05N01_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05N01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834605 ID=CF834605; Name=CF834605; organism=Citrus sinensis; type=EST; length=391bp
CCGTAGTCATGGGCCGCACTGGTTCAAGAGGACAGGTTACTCCAGTGAGA
GTCAAGTTTTTAGATGATCAGAACCGATTCATCATGAGGAATGTGAAGGG
ACCCGTTAGAGAAGGTGATATCCTCACTTTGCTCGAGTCTGAGAGAGAAG
CTAGGAGGCTCCGTTGAAGAGTCCATCTCTGGTCATACTATCTCAAACTT
TTTGTTGGAAACTAGGGTTCATTACTGTTGTTTTTAGTAGGCTAGTGATT
GGCAATGTTATGAGTTTCACAACTTATTTTGAAGGTTTTCATATTAAGAC
TGGGTTTTGAGCCATGAATTATATGTTTTGGGATGTTTAATATCGTTCTC
TTTGAAATGGAGTTAAATTTGCTTTAAAAAAAAAAAAAAAA
back to top