CF834938

Overview
NameCF834938
Unique NameCF834938
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length714
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig907 contig Csv1_Contig907:100..813. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF834938 vs. ExPASy Swiss-Prot
Match: PSBO_SOLTU (Oxygen-evolving enhancer protein 1, chloroplastic OS=Solanum tuberosum GN=PSBO PE=2 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 1.397e-101
Identity = 189/225 (84.00%), Postives = 199/225 (88.44%), Query Frame = 1
Query:   40 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKP 714
            MAASLQAAATLMQPTKVG V A            VSKAFG++ + +R+SCSL  DLKD AQKC DA KIAGFALATSALVVSGA+AEGVPKRLT+DEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY AKKFCLEPTSFTVKAEGV+KN+ PDFQ TKLMTRLTYTLDEIEGPFEVSPDGT+KF EKDGIDYAAVTVQL GGERVPFLFTIKQLVASGKP
Sbjct:    1 MAASLQAAATLMQPTKVGGVSARNNLQLRSSQS-VSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKP 224          
BLAST of CF834938 vs. ExPASy Swiss-Prot
Match: PSBO_TOBAC (Oxygen-evolving enhancer protein 1, chloroplastic OS=Nicotiana tabacum GN=PSBO PE=2 SV=1)

HSP 1 Score: 368.622 bits (945), Expect = 1.824e-101
Identity = 190/225 (84.44%), Postives = 198/225 (88.00%), Query Frame = 1
Query:   40 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKP 714
            MAASLQAAATLMQPTKVGV PA            VSKAFGV+ A AR++CSL  +LKDLAQK  DA K+AGFALATSALVVSGA+AEGVPKRLT+DEIQSKTYMEVKGTGTANQCPTIDGGV SFAFKPGKY AKKFCLEPTSFTVKAE VNKNAPPDFQ TKLMTRLTYTLDEIEGPFEVS DGT+KF EKDGIDYAAVTVQL GGERVPFLFTIKQLVASGKP
Sbjct:    1 MAASLQAAATLMQPTKVGVAPARNNLQLRSAQS-VSKAFGVEPAAARLTCSLQTELKDLAQKFTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKP 224          
BLAST of CF834938 vs. ExPASy Swiss-Prot
Match: PSBO_SOLLC (Oxygen-evolving enhancer protein 1, chloroplastic OS=Solanum lycopersicum GN=PSBO PE=2 SV=2)

HSP 1 Score: 362.073 bits (928), Expect = 1.707e-99
Identity = 185/225 (82.22%), Postives = 196/225 (87.11%), Query Frame = 1
Query:   40 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKP 714
            MAASLQAAATLMQPTKVGV               VSKAFGV+    R++CSL  ++K+LAQKC DA KIAGFALATSALVVSGA+AEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTI+GGV SFAFKPGKY AKKFCLEPTSFTVKAEGV+KN+ PDFQ TKLMTRLTYTLDEIEGPFEVSPDGT+KF EKDGIDYAAVTVQL GGERVPFLFTIKQLVASGKP
Sbjct:    1 MAASLQAAATLMQPTKVGV----RNNLQLRSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKP 221          
BLAST of CF834938 vs. ExPASy Swiss-Prot
Match: PSBO_PEA (Oxygen-evolving enhancer protein 1, chloroplastic OS=Pisum sativum GN=PSBO PE=2 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 7.422e-95
Identity = 177/225 (78.67%), Postives = 193/225 (85.78%), Query Frame = 1
Query:   40 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKP 714
            MAASLQAAATLMQPTK+                 VSKAFG++  GA+++CSL +D K+LA KCV+A+KIAGFALATSALVVSGASAEG PKRLT+DEIQSKTY+EVKGTGTANQCPTIDGGVDSF+FKPGKY AKK CLEPTSFTVK+EGV KN P  FQNTKLMTRLTYTLDEIEGPFEVS DG++KF EKDGIDYAAVTVQL GGERVPFLFTIKQLVASGKP
Sbjct:    1 MAASLQAAATLMQPTKL-----RSNTLQLKSNQSVSKAFGLEHYGAKVTCSLQSDFKELAHKCVEASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFSFKPGKYNAKKLCLEPTSFTVKSEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSADGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKP 220          
BLAST of CF834938 vs. ExPASy Swiss-Prot
Match: PSBO2_ARATH (Oxygen-evolving enhancer protein 1-2, chloroplastic OS=Arabidopsis thaliana GN=PSBO2 PE=1 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 3.448e-92
Identity = 169/225 (75.11%), Postives = 188/225 (83.56%), Query Frame = 1
Query:   40 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKP 714
            MA SLQAAAT +QP K+   P+            V K+FG+DS+ AR++CSL++DLKD A KC DA KIAGFALATSALVVSGA AEG PKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG ++F+FK GKY  KKFC EPTSFTVKA+ V+KNAPPDFQNTKLMTRLTYTLDEIEGPFEV  DG++KF E+DGIDYAAVTVQL GGERVPFLFT+KQL ASGKP
Sbjct:    1 MATSLQAAATFLQPAKIAASPSRNVHLRSNQT--VGKSFGLDSSQARLTCSLHSDLKDFAGKCSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKAGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKP 223          
BLAST of CF834938 vs. ExPASy Swiss-Prot
Match: PSBO_FRIAG (Oxygen-evolving enhancer protein 1, chloroplastic OS=Fritillaria agrestis GN=PSBO PE=2 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 4.503e-92
Identity = 172/226 (76.11%), Postives = 196/226 (86.73%), Query Frame = 1
Query:   40 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGA-RISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKP 714
            MA+SLQAAATL+ P KVG  PA            +SKAFG D++ A R++CS+N+DL+D+AQKC DA K+AGFALATSALV+SGASAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG +SF +K GKY  KK CLEPTSFTVKAEG+NKNAPP+FQ TKLMTRLTYTLDEIEGPFEV+PDGT+KF EKDGIDYAAVTVQL GGERVPFLFT+KQLVA+GKP
Sbjct:    1 MASSLQAAATLI-PAKVGA-PARTHLRSNSH---LSKAFGFDNSTAGRLTCSINSDLRDIAQKCTDAAKLAGFALATSALVISGASAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGTESFGYKTGKYTLKKLCLEPTSFTVKAEGINKNAPPEFQKTKLMTRLTYTLDEIEGPFEVAPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKP 221          
BLAST of CF834938 vs. ExPASy Swiss-Prot
Match: PSBO_SPIOL (Oxygen-evolving enhancer protein 1, chloroplastic OS=Spinacia oleracea GN=PSBO PE=1 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 1.711e-91
Identity = 175/227 (77.09%), Postives = 191/227 (84.14%), Query Frame = 1
Query:   40 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSA--GARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKP 714
            MAASLQA+ T +QPTKV    A            V KAFGV+SA  G R+S SL +DLK+LA KCVDATK+AG ALATSAL+ SGA+AEG  KRLTYDEIQSKTY+EVKGTGTANQCPT++GGVDSFAFKPGKY AKKFCLEPT F VKAEG++KN+ PDFQNTKLMTRLTYTLDEIEGPFEVS DGT+KF EKDGIDYAAVTVQL GGERVPFLFTIKQLVASGKP
Sbjct:    1 MAASLQASTTFLQPTKV----ASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANKCVDATKLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKP 222          
BLAST of CF834938 vs. ExPASy Swiss-Prot
Match: PSBO1_ARATH (Oxygen-evolving enhancer protein 1-1, chloroplastic OS=Arabidopsis thaliana GN=PSBO1 PE=1 SV=2)

HSP 1 Score: 328.561 bits (841), Expect = 2.092e-89
Identity = 162/225 (72.00%), Postives = 185/225 (82.22%), Query Frame = 1
Query:   40 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKP 714
            MAASLQ+ AT +Q  K+   P+            V K+FG++++ AR++CS  +D KD   KC DA KIAGFALATSALVVSGASAEG PKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG ++F+FKPGKY  KKFC EPTSFTVKA+ V+KNAPP+FQNTKLMTRLTYTLDEIEGPFEV+ DG++ F E+DGIDYAAVTVQL GGERVPFLFT+KQL ASGKP
Sbjct:    1 MAASLQSTATFLQSAKIATAPSRGSSHLRSTQA-VGKSFGLETSSARLTCSFQSDFKDFTGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKP 224          
BLAST of CF834938 vs. ExPASy Swiss-Prot
Match: PSBO_WHEAT (Oxygen-evolving enhancer protein 1, chloroplastic OS=Triticum aestivum GN=PSBO PE=2 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 7.439e-87
Identity = 166/225 (73.78%), Postives = 186/225 (82.67%), Query Frame = 1
Query:   40 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKP 714
            MAASLQAAAT+M P K+G                V++AFGVD AGARI+CSL +D++++A KC DA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKGTGTANQCPTIDGGVDSF FK GKY+ KKFCLEPTSFTVKAEG+ KN PP FQ TKLMTRLTYTLDE+EGP EV    T+KF EKDGIDYAAVTVQL GGERV FLFT+KQLVA+GKP
Sbjct:    1 MAASLQAAATVM-PAKIG-----GRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCADAAKMAGFALATSALLVSGATAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFPFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPRFQKTKLMTRLTYTLDEMEGPLEVRRRRTLKFEEKDGIDYAAVTVQLPGGERVAFLFTVKQLVATGKP 218          
BLAST of CF834938 vs. ExPASy Swiss-Prot
Match: PSBO_VOLCA (Oxygen-evolving enhancer protein 1, chloroplastic OS=Volvox carteri GN=PSBO PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 5.776e-39
Identity = 82/153 (53.59%), Postives = 99/153 (64.71%), Query Frame = 1
Query:  253 FALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTID-GGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASG 708
            F  A +A+V + A   G    LTYDE+Q  TY++VKGTG AN CP ++ G  D      G Y+ + FC+EPTSFTVK E V K    +F  TKLMTRLTYTLD + G  +V  DG+ +  E+DGIDYAA TVQL GGERV FLFTIKQ    G
Sbjct:   32 FGQAAAAVVAASALVAGSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTVKEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLKVGSDGSAELKEEDGIDYAATTVQLPGGERVAFLFTIKQFDGKG 184          
The following BLAST results are available for this feature:
BLAST of CF834938 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
PSBO_SOLTU1.397e-10184.00Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_TOBAC1.824e-10184.44Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_SOLLC1.707e-9982.22Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_PEA7.422e-9578.67Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO2_ARATH3.448e-9275.11Oxygen-evolving enhancer protein 1-2, chloroplasti... [more]
PSBO_FRIAG4.503e-9276.11Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_SPIOL1.711e-9177.09Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO1_ARATH2.092e-8972.00Oxygen-evolving enhancer protein 1-1, chloroplasti... [more]
PSBO_WHEAT7.439e-8773.78Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_VOLCA5.776e-3953.59Oxygen-evolving enhancer protein 1, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06G04_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06G04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834938 ID=CF834938|Name=CF834938|organism=Citrus sinensis|type=EST|length=714bp
GGGATACTAGCAAGTAACCCACAAGTGGTAGGGAGCAAGATGGCAGCCTC
GTTACAAGCCGCAGCTACACTGATGCAACCCACCAAGGTGGGTGTGGTAC
CCGCTCGCAGCAGCAGCCTGCAGCTGAGGTCTTCACAGAGCGTTTCGAAG
GCTTTTGGTGTCGACTCAGCTGGTGCTAGGATCTCTTGCTCTTTGAATAA
TGACTTGAAGGATTTGGCTCAGAAATGTGTTGATGCTACCAAGATCGCTG
GCTTTGCCCTCGCCACTTCTGCTCTCGTCGTTTCGGGAGCAAGTGCTGAA
GGTGTTCCAAAGAGGCTAACCTATGATGAAATCCAGAGCAAGACATACAT
GGAAGTGAAGGGAACCGGAACTGCTAACCAGTGCCCAACCATTGATGGCG
GAGTTGACTCTTTTGCCTTCAAACCTGGCAAATACCAGGCTAAGAAGTTC
TGCCTAGAACCAACTTCCTTCACTGTCAAGGCTGAGGGTGTCAACAAGAA
TGCCCCACCAGATTTCCAGAACACCAAGCTCATGACCCGCCTTACCTACA
CCCTTGACGAGATTGAGGGACCTTTTGAAGTGTCCCCCGATGGCACCATT
AAGTTTGTGGAGAAGGATGGAATTGACTATGCTGCTGTGACAGTTCAGCT
GGCTGGAGGCGAGCGTGTGCCCTTCCTTTTCACCATCAAACAATTGGTAG
CATCAGGCAAACCT
back to top