CF834944

Overview
NameCF834944
Unique NameCF834944
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length534
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF834944 vs. ExPASy Swiss-Prot
Match: BAS1A_ARATH (2-Cys peroxiredoxin BAS1, chloroplastic OS=Arabidopsis thaliana GN=BAS1 PE=1 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 1.329e-48
Identity = 90/107 (84.11%), Postives = 101/107 (94.39%), Query Frame = -1
Query:  214 KSGGLGDLKYPLIGDITKSISKSYGILIRDQGIALRGLFIIDKEGVIQQSSVNNLAIGRSVEETLRTLQALQFVQENPDEVCPSGWKPGVKSMKPDPKLSKEYFAAI 534
            KSGGLGDL YPLI D+TKSISKS+G+LI DQGIALRGLFIIDKEGVIQ S++NNL IGRSV+ET+RTLQALQ++QENPDEVCP+GWKPG KSMKPDPKLSKEYF+AI
Sbjct:  160 KSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI 266          
BLAST of CF834944 vs. ExPASy Swiss-Prot
Match: BAS1_ORYSJ (2-Cys peroxiredoxin BAS1, chloroplastic OS=Oryza sativa subsp. japonica GN=BAS1 PE=1 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.736e-48
Identity = 92/107 (85.98%), Postives = 102/107 (95.33%), Query Frame = -1
Query:  214 KSGGLGDLKYPLIGDITKSISKSYGILIRDQGIALRGLFIIDKEGVIQQSSVNNLAIGRSVEETLRTLQALQFVQENPDEVCPSGWKPGVKSMKPDPKLSKEYFAAI 534
            KSGGLGDLKYPLI D+TKSISKS+G+LI DQGIALRGLFIIDKEGVIQ S++NNLAIGRSV+ET+RTLQALQ+VQ+NPDEVCP+GWKPG KSMKPDPK SKEYFAAI
Sbjct:  155 KSGGLGDLKYPLISDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQDNPDEVCPAGWKPGDKSMKPDPKGSKEYFAAI 261          
BLAST of CF834944 vs. ExPASy Swiss-Prot
Match: BAS1B_ARATH (2-Cys peroxiredoxin BAS1-like, chloroplastic OS=Arabidopsis thaliana GN=At5g06290 PE=2 SV=2)

HSP 1 Score: 191.815 bits (486), Expect = 1.736e-48
Identity = 91/107 (85.05%), Postives = 101/107 (94.39%), Query Frame = -1
Query:  214 KSGGLGDLKYPLIGDITKSISKSYGILIRDQGIALRGLFIIDKEGVIQQSSVNNLAIGRSVEETLRTLQALQFVQENPDEVCPSGWKPGVKSMKPDPKLSKEYFAAI 534
            KSGGLGDL YPL+ DITKSISKS+G+LI DQGIALRGLFIIDKEGVIQ S++NNL IGRSV+ET+RTLQALQ+VQENPDEVCP+GWKPG KSMKPDPKLSKEYF+AI
Sbjct:  165 KSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI 271          
BLAST of CF834944 vs. ExPASy Swiss-Prot
Match: BAS1_HORVU (2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) OS=Hordeum vulgare GN=BAS1 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.376e-45
Identity = 89/107 (83.18%), Postives = 100/107 (93.46%), Query Frame = -1
Query:  214 KSGGLGDLKYPLIGDITKSISKSYGILIRDQGIALRGLFIIDKEGVIQQSSVNNLAIGRSVEETLRTLQALQFVQENPDEVCPSGWKPGVKSMKPDPKLSKEYFAAI 534
            KSGGLGDLKYPL+ D+TKSISKS+G+LI DQGIALRGLFIIDKEGVIQ S++NNL IGRSV+ETLRTLQALQ+V++ PDEVCP+GWKPG KSMKPDPK SKEYFAAI
Sbjct:  105 KSGGLGDLKYPLVSDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETLRTLQALQYVKK-PDEVCPAGWKPGEKSMKPDPKGSKEYFAAI 210          
BLAST of CF834944 vs. ExPASy Swiss-Prot
Match: BAS1_SPIOL (2-Cys peroxiredoxin BAS1, chloroplastic OS=Spinacia oleracea GN=BAS1 PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.797e-45
Identity = 88/107 (82.24%), Postives = 98/107 (91.59%), Query Frame = -1
Query:  214 KSGGLGDLKYPLIGDITKSISKSYGILIRDQGIALRGLFIIDKEGVIQQSSVNNLAIGRSVEETLRTLQALQFVQENPDEVCPSGWKPGVKSMKPDPKLSKEYFAAI 534
            KSGGLGDL YPLI D+TKSISKS+G+LI DQGIALRGLFIIDKEGVIQ S++NNL IGRSV+ET+RTLQALQ+   NPDEVCP+GWKPG KSMKPDPKLSKEYF+AI
Sbjct:  160 KSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYT-GNPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI 265          
BLAST of CF834944 vs. ExPASy Swiss-Prot
Match: BAS1_WHEAT (2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) OS=Triticum aestivum GN=TSA PE=1 SV=2)

HSP 1 Score: 180.644 bits (457), Expect = 4.002e-45
Identity = 88/107 (82.24%), Postives = 100/107 (93.46%), Query Frame = -1
Query:  214 KSGGLGDLKYPLIGDITKSISKSYGILIRDQGIALRGLFIIDKEGVIQQSSVNNLAIGRSVEETLRTLQALQFVQENPDEVCPSGWKPGVKSMKPDPKLSKEYFAAI 534
            KSGGLGDLKYPL+ D+TKSISKS+G+LI DQGIALRGLFIIDKEGVIQ S++NNL IGRSV+ETLRTL+ALQ+V++ PDEVCP+GWKPG KSMKPDPK SKEYFAAI
Sbjct:  105 KSGGLGDLKYPLVSDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETLRTLRALQYVKK-PDEVCPAGWKPGEKSMKPDPKGSKEYFAAI 210          
BLAST of CF834944 vs. ExPASy Swiss-Prot
Match: YCF42_PORYE (Putative peroxiredoxin ycf42 OS=Porphyra yezoensis GN=ycf42 PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.755e-35
Identity = 70/106 (66.04%), Postives = 85/106 (80.19%), Query Frame = -1
Query:  217 KSGGLGDLKYPLIGDITKSISKSYGILIRDQGIALRGLFIIDKEGVIQQSSVNNLAIGRSVEETLRTLQALQFVQENPDEVCPSGWKPGVKSMKPDPKLSKEYFAA 534
            +SGGLGDL YPL+ D+ K IS +Y +L  D G+ALRGLFIID +G+IQ S++NNL  GRSVEETLR LQA+Q+VQ +PDEVCP+ WKPG K+M PDP  SK YFAA
Sbjct:   94 ESGGLGDLSYPLVSDLKKEISAAYNVLNSD-GVALRGLFIIDPKGIIQYSTINNLEFGRSVEETLRVLQAIQYVQSHPDEVCPANWKPGDKTMNPDPIKSKNYFAA 198          
BLAST of CF834944 vs. ExPASy Swiss-Prot
Match: YCF42_PORPU (Putative peroxiredoxin ycf42 OS=Porphyra purpurea GN=ycf42 PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 3.179e-34
Identity = 69/106 (65.09%), Postives = 85/106 (80.19%), Query Frame = -1
Query:  217 KSGGLGDLKYPLIGDITKSISKSYGILIRDQGIALRGLFIIDKEGVIQQSSVNNLAIGRSVEETLRTLQALQFVQENPDEVCPSGWKPGVKSMKPDPKLSKEYFAA 534
            +SGGLGDL+YPL+ D+ K IS +Y +L    G+ALRGLFIID +G+IQ S+VNNL  GRSVEETLR LQA+Q+VQ +PDEVCP+ WKPG ++M PDP  SK YFAA
Sbjct:   94 ESGGLGDLEYPLVSDLKKEISIAYNVL-NSGGVALRGLFIIDPKGIIQYSTVNNLEFGRSVEETLRVLQAIQYVQAHPDEVCPANWKPGDRTMNPDPIKSKNYFAA 198          
BLAST of CF834944 vs. ExPASy Swiss-Prot
Match: Y755_SYNY3 (Putative peroxiredoxin sll0755 OS=Synechocystis sp. (strain PCC 6803) GN=sll0755 PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 5.611e-31
Identity = 60/109 (55.05%), Postives = 85/109 (77.98%), Query Frame = -1
Query:  208 KSGGLGDLKYPLIGDITKSISKSYGILIRDQGIALRGLFIIDKEGVIQQSSVNNLAIGRSVEETLRTLQALQFVQENPDEVCPSGWKPGVKSMKPDPKLSKEYFAAI*E 534
            K GG+G++ YPL+ D+ K IS++Y +L  D GIALRGLFIID+EG++Q ++VNNL+ GRSV+ETLR L+A++ VQ +P+EVCP  W+ G K+M PDP+ +K YF  + E
Sbjct:   91 KMGGIGNINYPLVSDLKKEISQAYNVLEPDAGIALRGLFIIDREGILQYATVNNLSFGRSVDETLRVLKAIRHVQSHPNEVCPVDWQEGDKTMIPDPEKAKTYFETVAE 199          
BLAST of CF834944 vs. ExPASy Swiss-Prot
Match: PRDX2_RAT (Peroxiredoxin-2 OS=Rattus norvegicus GN=Prdx2 PE=1 SV=3)

HSP 1 Score: 127.487 bits (319), Expect = 4.021e-29
Identity = 60/105 (57.14%), Postives = 82/105 (78.10%), Query Frame = -1
Query:  220 KSGGLGDLKYPLIGDITKSISKSYGILIRDQGIALRGLFIIDKEGVIQQSSVNNLAIGRSVEETLRTLQALQFVQENPDEVCPSGWKPGVKSMKPDPKLSKEYFA 534
            K GGLG L  PL+ D+TKS+S++YG+L  D+GIA RGLFIID +GV++Q +VN+L +GRSV+E LR +QA Q+  E+  EVCP+GWKPG  ++KP+   SKEYF+
Sbjct:   92 KEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEH-GEVCPAGWKPGSDTIKPNVDDSKEYFS 195          
The following BLAST results are available for this feature:
BLAST of CF834944 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 79
Match NameE-valueIdentityDescription
BAS1A_ARATH1.329e-4884.112-Cys peroxiredoxin BAS1, chloroplastic OS=Arabido... [more]
BAS1_ORYSJ1.736e-4885.982-Cys peroxiredoxin BAS1, chloroplastic OS=Oryza s... [more]
BAS1B_ARATH1.736e-4885.052-Cys peroxiredoxin BAS1-like, chloroplastic OS=Ar... [more]
BAS1_HORVU1.376e-4583.182-Cys peroxiredoxin BAS1, chloroplastic (Fragment)... [more]
BAS1_SPIOL1.797e-4582.242-Cys peroxiredoxin BAS1, chloroplastic OS=Spinaci... [more]
BAS1_WHEAT4.002e-4582.242-Cys peroxiredoxin BAS1, chloroplastic (Fragment)... [more]
YCF42_PORYE3.755e-3566.04Putative peroxiredoxin ycf42 OS=Porphyra yezoensis... [more]
YCF42_PORPU3.179e-3465.09Putative peroxiredoxin ycf42 OS=Porphyra purpurea ... [more]
Y755_SYNY35.611e-3155.05Putative peroxiredoxin sll0755 OS=Synechocystis sp... [more]
PRDX2_RAT4.021e-2957.14Peroxiredoxin-2 OS=Rattus norvegicus GN=Prdx2 PE=1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06G10_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06G10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834944 ID=CF834944|Name=CF834944|organism=Citrus sinensis|type=EST|length=534bp
AGAGGCCCTTTAAAAGAGATTTTGTTGTGCCTGCATTACAAAGGAACCCT
TAAGGGGGACAAATCCAGTCCAATGCATTTATTCCCCACAGGCATGCTCC
GCAAAACTCAACAGATAAGTAGCAAAATCACATTACATGGAAAAACAAAA
CTCATCTACCCCTCCCTAATAGACATAGATATGCATACCAGGTTCCAATG
CTAACCCCTCTTATATAGCTGCAAAGTACTCCTTGCTGAGTTTTGGGTCT
GGCTTCATGGATTTGACCCCGGGCTTCCATCCTGATGGGCAAACTTCATC
TGGGTTCTCCTGCACAAACTGCAAGGCCTGAAGTGTTCTCAGTGTCTCTT
CAACACTCCTACCAATGGCAAGGTTGTTAACGGATGACTGCTGGATGACT
CCTTCTTTGTCAATAATAAAGAGTCCTCTCAATGCAATTCCCTGATCACG
GATCAGAATACCATAGGATTTTGAAATTGATTTGGTGATATCACCAATTA
GGGGGTACTTCAAATCACCAAGACCACCTGACTT
back to top