CF834945

Overview
NameCF834945
Unique NameCF834945
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length773
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11471 contig Csv1_Contig11471:353..1125. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF834945 vs. ExPASy Swiss-Prot
Match: BAS1_ORYSJ (2-Cys peroxiredoxin BAS1, chloroplastic OS=Oryza sativa subsp. japonica GN=BAS1 PE=1 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 3.436e-96
Identity = 173/186 (93.01%), Postives = 179/186 (96.24%), Query Frame = 2
Query:    2 DFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFCDRYAEFEKLNTEILGVSTDSVFSHLAWVQTDRKSGGLGDLKYPLIADITKSISKSYGILIPDQGIALRGLFIIDKEGVIQHSTIINLAIGRSVD*TLRTLQALQYVQENPDEVCPAGWKPGDKSMKPDPKLSKEYFAAI 559
            DF AEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAF DRY EFEKLNTEILGVS DSVFSHLAWVQTDRKSGGLGDLKYPLI+D+TKSISKS+G+LIPDQGIALRGLFIIDKEGVIQHSTI NLAIGRSVD T+RTLQALQYVQ+NPDEVCPAGWKPGDKSMKPDPK SKEYFAAI
Sbjct:   76 DFDAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYDEFEKLNTEILGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQDNPDEVCPAGWKPGDKSMKPDPKGSKEYFAAI 261          
BLAST of CF834945 vs. ExPASy Swiss-Prot
Match: BAS1B_ARATH (2-Cys peroxiredoxin BAS1-like, chloroplastic OS=Arabidopsis thaliana GN=At5g06290 PE=2 SV=2)

HSP 1 Score: 346.28 bits (887), Expect = 1.105e-94
Identity = 168/186 (90.32%), Postives = 177/186 (95.16%), Query Frame = 2
Query:    2 DFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFCDRYAEFEKLNTEILGVSTDSVFSHLAWVQTDRKSGGLGDLKYPLIADITKSISKSYGILIPDQGIALRGLFIIDKEGVIQHSTIINLAIGRSVD*TLRTLQALQYVQENPDEVCPAGWKPGDKSMKPDPKLSKEYFAAI 559
            DF AEAVFDQEFI VKLS+YIGKKYVILFFYPLDFTFVCPTEITAF DRY EFEKLNTE+LGVS DSVFSHLAWVQTDRKSGGLGDL YPL++DITKSISKS+G+LIPDQGIALRGLFIIDKEGVIQHSTI NL IGRSVD T+RTLQALQYVQENPDEVCPAGWKPG+KSMKPDPKLSKEYF+AI
Sbjct:   86 DFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI 271          
BLAST of CF834945 vs. ExPASy Swiss-Prot
Match: BAS1A_ARATH (2-Cys peroxiredoxin BAS1, chloroplastic OS=Arabidopsis thaliana GN=BAS1 PE=1 SV=2)

HSP 1 Score: 342.813 bits (878), Expect = 1.222e-93
Identity = 166/186 (89.25%), Postives = 177/186 (95.16%), Query Frame = 2
Query:    2 DFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFCDRYAEFEKLNTEILGVSTDSVFSHLAWVQTDRKSGGLGDLKYPLIADITKSISKSYGILIPDQGIALRGLFIIDKEGVIQHSTIINLAIGRSVD*TLRTLQALQYVQENPDEVCPAGWKPGDKSMKPDPKLSKEYFAAI 559
            DF AEAVFDQEFI VKLSDYIGKKYVILFFYPLDFTFVCPTEITAF DR++EFEKLNTE+LGVS DSVFSHLAWVQTDRKSGGLGDL YPLI+D+TKSISKS+G+LI DQGIALRGLFIIDKEGVIQHSTI NL IGRSVD T+RTLQALQY+QENPDEVCPAGWKPG+KSMKPDPKLSKEYF+AI
Sbjct:   81 DFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI 266          
BLAST of CF834945 vs. ExPASy Swiss-Prot
Match: BAS1_HORVU (2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) OS=Hordeum vulgare GN=BAS1 PE=2 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 2.305e-92
Identity = 167/186 (89.78%), Postives = 178/186 (95.70%), Query Frame = 2
Query:    2 DFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFCDRYAEFEKLNTEILGVSTDSVFSHLAWVQTDRKSGGLGDLKYPLIADITKSISKSYGILIPDQGIALRGLFIIDKEGVIQHSTIINLAIGRSVD*TLRTLQALQYVQENPDEVCPAGWKPGDKSMKPDPKLSKEYFAAI 559
            DFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAF DR+ EFEK+NTEILGVS DSVFSHLAWVQT+RKSGGLGDLKYPL++D+TKSISKS+G+LIPDQGIALRGLFIIDKEGVIQHSTI NL IGRSVD TLRTLQALQYV++ PDEVCPAGWKPG+KSMKPDPK SKEYFAAI
Sbjct:   26 DFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHEEFEKINTEILGVSVDSVFSHLAWVQTERKSGGLGDLKYPLVSDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETLRTLQALQYVKK-PDEVCPAGWKPGEKSMKPDPKGSKEYFAAI 210          
BLAST of CF834945 vs. ExPASy Swiss-Prot
Match: BAS1_WHEAT (2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) OS=Triticum aestivum GN=TSA PE=1 SV=2)

HSP 1 Score: 337.035 bits (863), Expect = 6.706e-92
Identity = 166/186 (89.25%), Postives = 178/186 (95.70%), Query Frame = 2
Query:    2 DFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFCDRYAEFEKLNTEILGVSTDSVFSHLAWVQTDRKSGGLGDLKYPLIADITKSISKSYGILIPDQGIALRGLFIIDKEGVIQHSTIINLAIGRSVD*TLRTLQALQYVQENPDEVCPAGWKPGDKSMKPDPKLSKEYFAAI 559
            DFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAF DR+ EFEK+NTEILGVS DSVFSHLAWVQT+RKSGGLGDLKYPL++D+TKSISKS+G+LIPDQGIALRGLFIIDKEGVIQHSTI NL IGRSVD TLRTL+ALQYV++ PDEVCPAGWKPG+KSMKPDPK SKEYFAAI
Sbjct:   26 DFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHEEFEKINTEILGVSVDSVFSHLAWVQTERKSGGLGDLKYPLVSDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETLRTLRALQYVKK-PDEVCPAGWKPGEKSMKPDPKGSKEYFAAI 210          
BLAST of CF834945 vs. ExPASy Swiss-Prot
Match: BAS1_SPIOL (2-Cys peroxiredoxin BAS1, chloroplastic OS=Spinacia oleracea GN=BAS1 PE=2 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 1.652e-90
Identity = 164/186 (88.17%), Postives = 174/186 (93.55%), Query Frame = 2
Query:    2 DFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFCDRYAEFEKLNTEILGVSTDSVFSHLAWVQTDRKSGGLGDLKYPLIADITKSISKSYGILIPDQGIALRGLFIIDKEGVIQHSTIINLAIGRSVD*TLRTLQALQYVQENPDEVCPAGWKPGDKSMKPDPKLSKEYFAAI 559
            DF AEAVFDQEFI VKLSDYIGKKYVILFFYPLDFTFVCPTEITAF DR++EFEKLNTE+LGVS DSVFSHLAWVQTDRKSGGLGDL YPLI+D+TKSISKS+G+LI DQGIALRGLFIIDKEGVIQHSTI NL IGRSVD T+RTLQALQY   NPDEVCPAGWKPG+KSMKPDPKLSKEYF+AI
Sbjct:   81 DFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYT-GNPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI 265          
BLAST of CF834945 vs. ExPASy Swiss-Prot
Match: YCF42_PORYE (Putative peroxiredoxin ycf42 OS=Porphyra yezoensis GN=ycf42 PE=3 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 3.239e-70
Identity = 128/185 (69.19%), Postives = 153/185 (82.70%), Query Frame = 2
Query:    2 DFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFCDRYAEFEKLNTEILGVSTDSVFSHLAWVQTDRKSGGLGDLKYPLIADITKSISKSYGILIPDQGIALRGLFIIDKEGVIQHSTIINLAIGRSVD*TLRTLQALQYVQENPDEVCPAGWKPGDKSMKPDPKLSKEYFAA 556
            DF+A AV+DQEF  +KLSD +  KY++LFFYPLDFTFVCPTEITAF D+Y  F +LNTE+LGVS DS +SHLAW+QTDR+SGGLGDL YPL++D+ K IS +Y +L  D G+ALRGLFIID +G+IQ+STI NL  GRSV+ TLR LQA+QYVQ +PDEVCPA WKPGDK+M PDP  SK YFAA
Sbjct:   16 DFSATAVYDQEFKTLKLSD-LKNKYIVLFFYPLDFTFVCPTEITAFSDKYNAFSELNTEVLGVSVDSEYSHLAWLQTDRESGGLGDLSYPLVSDLKKEISAAYNVLNSD-GVALRGLFIIDPKGIIQYSTINNLEFGRSVEETLRVLQAIQYVQSHPDEVCPANWKPGDKTMNPDPIKSKNYFAA 198          
BLAST of CF834945 vs. ExPASy Swiss-Prot
Match: YCF42_PORPU (Putative peroxiredoxin ycf42 OS=Porphyra purpurea GN=ycf42 PE=3 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 3.239e-70
Identity = 128/185 (69.19%), Postives = 155/185 (83.78%), Query Frame = 2
Query:    2 DFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFCDRYAEFEKLNTEILGVSTDSVFSHLAWVQTDRKSGGLGDLKYPLIADITKSISKSYGILIPDQGIALRGLFIIDKEGVIQHSTIINLAIGRSVD*TLRTLQALQYVQENPDEVCPAGWKPGDKSMKPDPKLSKEYFAA 556
            DF+A AV+DQEF  +KLSD+   KYVILFFYPLDFTFVCPTEITAF D+Y++F +LNTEILGVS DS +SHLAW+QTDR+SGGLGDL+YPL++D+ K IS +Y +L    G+ALRGLFIID +G+IQ+ST+ NL  GRSV+ TLR LQA+QYVQ +PDEVCPA WKPGD++M PDP  SK YFAA
Sbjct:   16 DFSATAVYDQEFKTIKLSDF-KNKYVILFFYPLDFTFVCPTEITAFSDKYSDFSELNTEILGVSVDSEYSHLAWLQTDRESGGLGDLEYPLVSDLKKEISIAYNVL-NSGGVALRGLFIIDPKGIIQYSTVNNLEFGRSVEETLRVLQAIQYVQAHPDEVCPANWKPGDRTMNPDPIKSKNYFAA 198          
BLAST of CF834945 vs. ExPASy Swiss-Prot
Match: Y755_SYNY3 (Putative peroxiredoxin sll0755 OS=Synechocystis sp. (strain PCC 6803) GN=sll0755 PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.839e-65
Identity = 114/188 (60.64%), Postives = 152/188 (80.85%), Query Frame = 2
Query:    2 DFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFCDRYAEFEKLNTEILGVSTDSVFSHLAWVQTDRKSGGLGDLKYPLIADITKSISKSYGILIPDQGIALRGLFIIDKEGVIQHSTIINLAIGRSVD*TLRTLQALQYVQENPDEVCPAGWKPGDKSMKPDPKLSKEYFAAI*E 565
            DF A A+ DQ F  VKLS Y GK Y++LFFYPLDFTFVCPTEI AF DR++EF  L+TE++G+S DS FSHLAW+QT+RK GG+G++ YPL++D+ K IS++Y +L PD GIALRGLFIID+EG++Q++T+ NL+ GRSVD TLR L+A+++VQ +P+EVCP  W+ GDK+M PDP+ +K YF  + E
Sbjct:   13 DFTATAIVDQSFQTVKLSTYRGK-YLVLFFYPLDFTFVCPTEIIAFSDRHSEFTALDTEVVGISVDSEFSHLAWIQTERKMGGIGNINYPLVSDLKKEISQAYNVLEPDAGIALRGLFIIDREGILQYATVNNLSFGRSVDETLRVLKAIRHVQSHPNEVCPVDWQEGDKTMIPDPEKAKTYFETVAE 199          
BLAST of CF834945 vs. ExPASy Swiss-Prot
Match: PRDX2_BOVIN (Peroxiredoxin-2 OS=Bos taurus GN=PRDX2 PE=2 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 4.387e-59
Identity = 114/184 (61.96%), Postives = 137/184 (74.46%), Query Frame = 2
Query:    2 DFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFCDRYAEFEKLNTEILGVSTDSVFSHLAWVQTDRKSGGLGDLKYPLIADITKSISKSYGILIPDQGIALRGLFIIDKEGVIQHSTIINLAIGRSVD*TLRTLQALQYVQENPDEVCPAGWKPGDKSMKPDPKLSKEYFA 553
            +F A AV D  F  VKLSDY GK YV+LFFYPLDFTFVCPTEI AF DR AEF KLN E+LGVS DS F+HLAW+ T RK GGLG L  PL+AD+T+ +S  YG+L  D+GIA RGLF+ID +GV++  TI +L +GRSVD  LR +QA QY  E+  EVCPAGW PG  ++KP+   SKEYF+
Sbjct:   15 EFQATAVVDGAFKEVKLSDYKGK-YVVLFFYPLDFTFVCPTEIVAFSDRAAEFHKLNCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRKLSSDYGVLKEDEGIAYRGLFVIDGKGVLRQVTINDLPVGRSVDEALRLVQAFQYTDEH-GEVCPAGWTPGSDTIKPNVDDSKEYFS 196          
The following BLAST results are available for this feature:
BLAST of CF834945 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 143
Match NameE-valueIdentityDescription
BAS1_ORYSJ3.436e-9693.012-Cys peroxiredoxin BAS1, chloroplastic OS=Oryza s... [more]
BAS1B_ARATH1.105e-9490.322-Cys peroxiredoxin BAS1-like, chloroplastic OS=Ar... [more]
BAS1A_ARATH1.222e-9389.252-Cys peroxiredoxin BAS1, chloroplastic OS=Arabido... [more]
BAS1_HORVU2.305e-9289.782-Cys peroxiredoxin BAS1, chloroplastic (Fragment)... [more]
BAS1_WHEAT6.706e-9289.252-Cys peroxiredoxin BAS1, chloroplastic (Fragment)... [more]
BAS1_SPIOL1.652e-9088.172-Cys peroxiredoxin BAS1, chloroplastic OS=Spinaci... [more]
YCF42_PORYE3.239e-7069.19Putative peroxiredoxin ycf42 OS=Porphyra yezoensis... [more]
YCF42_PORPU3.239e-7069.19Putative peroxiredoxin ycf42 OS=Porphyra purpurea ... [more]
Y755_SYNY31.839e-6560.64Putative peroxiredoxin sll0755 OS=Synechocystis sp... [more]
PRDX2_BOVIN4.387e-5961.96Peroxiredoxin-2 OS=Bos taurus GN=PRDX2 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06G10_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06G10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834945 ID=CF834945|Name=CF834945|organism=Citrus sinensis|type=EST|length=773bp
TGATTTTGCTGCAGAGGCTGTTTTCGATCAAGAGTTCATCAATGTCAAGC
TTTCGGATTACATTGGGAAGAAATATGTGATTCTCTTTTTCTACCCGTTG
GACTTCACATTTGTTTGCCCCACAGAAATCACTGCTTTCTGTGACCGATA
TGCTGAATTTGAGAAGCTAAACACAGAGATATTGGGTGTCTCAACTGACA
GTGTGTTTTCACACTTGGCATGGGTCCAAACAGACAGAAAGTCAGGTGGT
CTTGGTGATTTGAAGTACCCACTAATTGCTGATATCACCAAATCAATTTC
AAAATCCTATGGTATTCTGATCCCTGATCAGGGAATTGCATTGAGAGGAC
TCTTTATTATTGACAAAGAAGGAGTCATCCAGCACTCAACCATTATCAAC
CTTGCCATTGGTAGGAGTGTTGACTAGACACTGAGAACACTTCAGGCCTT
GCAGTACGTGCAGGAGAACCCAGATGAAGTTTGCCCAGCAGGATGGAAGC
CCGGGGACAAATCCATGAAGCCAGACCCAAAACTCAGCAAGGAGTACTTT
GCAGCTATATAAGAGGGGTTAGCATTGGAACCTCGTATGCATATCTATGT
CTATTAGGGAGGTGTAGATGAGTTTTGTTTTTCCATGTAATGTGATTTTG
CTACTTACTGTTGAGTTTTGCGGAGCAGCCTGTGGGGAATAAATGCATTG
GACTGGATTTGTCCACCTCTTTACTTCCTTTGTAATGCAGACACAACAAA
ATCTCTTGGTATTGTCCTCTTCA
back to top