CF834949

Overview
NameCF834949
Unique NameCF834949
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length409
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF834949 vs. ExPASy Swiss-Prot
Match: R27A2_ARATH (60S ribosomal protein L27a-2 OS=Arabidopsis thaliana GN=RPL27AB PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 3.363e-27
Identity = 55/70 (78.57%), Postives = 66/70 (94.29%), Query Frame = -1
Query:  200 LRNKFHCPIVNVDKLWSMVPQEVKAKASKDNVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTADE 409
            LRNKF CPIVN+DKLWS+VP++VKAK+SKDNVP+IDVTQ G+FKVLGKG LPEN+P VVKAKL+SKTA++
Sbjct:   64 LRNKFFCPIVNLDKLWSLVPEDVKAKSSKDNVPLIDVTQHGFFKVLGKGHLPENKPFVVKAKLISKTAEK 133          
BLAST of CF834949 vs. ExPASy Swiss-Prot
Match: R27A3_ARATH (60S ribosomal protein L27a-3 OS=Arabidopsis thaliana GN=RPL27AC PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 7.493e-27
Identity = 54/70 (77.14%), Postives = 66/70 (94.29%), Query Frame = -1
Query:  200 LRNKFHCPIVNVDKLWSMVPQEVKAKASKDNVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTADE 409
            LRNKF CPIVN+DKLWS+VP++VKAK++KDNVP+IDVTQ G+FKVLGKG LPEN+P VVKAKL+SKTA++
Sbjct:   64 LRNKFFCPIVNLDKLWSLVPEDVKAKSTKDNVPLIDVTQHGFFKVLGKGHLPENKPFVVKAKLISKTAEK 133          
BLAST of CF834949 vs. ExPASy Swiss-Prot
Match: RL27A_TETTH (60S ribosomal protein L27a OS=Tetrahymena thermophila GN=RPL27A PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 4.121e-17
Identity = 43/70 (61.43%), Postives = 54/70 (77.14%), Query Frame = -1
Query:  203 RNKFHCPIVNVDKLWSMVPQEVKAKASKD--NVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAD 406
            +N  HCP+VN+DKLWS+V    + K ++D   VP+IDVT+ G+FKVLGKG LP NQPVVVKAK  SKTA+
Sbjct:   67 KNPLHCPVVNIDKLWSLVSDATRQKYAEDKKKVPVIDVTKAGFFKVLGKGRLP-NQPVVVKAKYFSKTAE 135          
BLAST of CF834949 vs. ExPASy Swiss-Prot
Match: RL27A_OSCBR (60S ribosomal protein L27a OS=Oscheius brevesophaga GN=rpl-27a PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.015e-15
Identity = 37/68 (54.41%), Postives = 51/68 (75.00%), Query Frame = -1
Query:  203 RNKFHCPIVNVDKLWSMVPQEVKAKASKDNVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAD 406
            +N  +CP VNVD+LW++VP+E K K S +  P+ID  + GYFKVLGKG+LP+ QP++VKAK  S  A+
Sbjct:   65 KNHHYCPTVNVDRLWALVPEEQKTKVSAEKAPVIDCVKAGYFKVLGKGLLPK-QPLIVKAKFFSHEAE 131          
BLAST of CF834949 vs. ExPASy Swiss-Prot
Match: RL27A_DICDI (60S ribosomal protein L27a OS=Dictyostelium discoideum GN=rpl27a PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 5.038e-15
Identity = 35/73 (47.95%), Postives = 55/73 (75.34%), Query Frame = -1
Query:  200 LRNKFHCPIVNVDKLWSMVPQEVKAKASKDN---VPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTADE 409
            LRN++HCP V+++K+W++VP+ V+   +  N    P++DVTQ G+FKVLG G+LP  QP++VKA+  SK A++
Sbjct:   64 LRNQYHCPTVSLEKIWTLVPESVRKSLAAKNDGTAPVVDVTQKGFFKVLGHGILP-TQPIIVKARYFSKVAEK 135          
BLAST of CF834949 vs. ExPASy Swiss-Prot
Match: RL27A_EUPCR (60S ribosomal protein L27a OS=Euplotes crassus GN=RPL27A PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.914e-14
Identity = 38/72 (52.78%), Postives = 55/72 (76.39%), Query Frame = -1
Query:  200 LRNKFHCPIVNVDKLWSMVPQEVKAKASKDN--VPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTADE 409
            +RN+++CP +N+ KLWS+V +E + KA  D   V +IDV + GY+KVLGKG+LPE  P+VVKAKL + TA++
Sbjct:   64 MRNQYYCPSINLSKLWSLVTEEERQKAQTDKSKVILIDVVKHGYYKVLGKGLLPE-VPLVVKAKLFTPTAEK 134          
BLAST of CF834949 vs. ExPASy Swiss-Prot
Match: RL27A_RAT (60S ribosomal protein L27a OS=Rattus norvegicus GN=Rpl27a PE=1 SV=3)

HSP 1 Score: 76.6406 bits (187), Expect = 4.265e-14
Identity = 37/72 (51.39%), Postives = 53/72 (73.61%), Query Frame = -1
Query:  200 RNKFHCPIVNVDKLWSMVPQEVKAKASKDN---VPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTADE 406
            RN+  CP VN+DKLW++V ++ +  A+K+     P+IDV + GY+KVLGKG LP+ QPV+VKAK  S+ A+E
Sbjct:   65 RNQSFCPTVNLDKLWTLVSEQTRVNAAKNKNGVAPIIDVVRSGYYKVLGKGKLPK-QPVIVKAKFFSRRAEE 135          
BLAST of CF834949 vs. ExPASy Swiss-Prot
Match: RL27A_PONAB (60S ribosomal protein L27a OS=Pongo abelii GN=RPL27A PE=2 SV=3)

HSP 1 Score: 76.6406 bits (187), Expect = 4.265e-14
Identity = 37/72 (51.39%), Postives = 53/72 (73.61%), Query Frame = -1
Query:  200 RNKFHCPIVNVDKLWSMVPQEVKAKASKDN---VPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTADE 406
            RN+  CP VN+DKLW++V ++ +  A+K+     P+IDV + GY+KVLGKG LP+ QPV+VKAK  S+ A+E
Sbjct:   65 RNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPK-QPVIVKAKFFSRRAEE 135          
BLAST of CF834949 vs. ExPASy Swiss-Prot
Match: RL27A_PANTR (60S ribosomal protein L27a OS=Pan troglodytes GN=RPL27A PE=2 SV=3)

HSP 1 Score: 76.6406 bits (187), Expect = 4.265e-14
Identity = 37/72 (51.39%), Postives = 53/72 (73.61%), Query Frame = -1
Query:  200 RNKFHCPIVNVDKLWSMVPQEVKAKASKDN---VPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTADE 406
            RN+  CP VN+DKLW++V ++ +  A+K+     P+IDV + GY+KVLGKG LP+ QPV+VKAK  S+ A+E
Sbjct:   65 RNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPK-QPVIVKAKFFSRRAEE 135          
BLAST of CF834949 vs. ExPASy Swiss-Prot
Match: RL27A_MACFA (60S ribosomal protein L27a OS=Macaca fascicularis GN=RPL27A PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.265e-14
Identity = 37/72 (51.39%), Postives = 53/72 (73.61%), Query Frame = -1
Query:  200 RNKFHCPIVNVDKLWSMVPQEVKAKASKDN---VPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTADE 406
            RN+  CP VN+DKLW++V ++ +  A+K+     P+IDV + GY+KVLGKG LP+ QPV+VKAK  S+ A+E
Sbjct:   65 RNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPK-QPVIVKAKFFSRRAEE 135          
The following BLAST results are available for this feature:
BLAST of CF834949 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
R27A2_ARATH3.363e-2778.5760S ribosomal protein L27a-2 OS=Arabidopsis thalia... [more]
R27A3_ARATH7.493e-2777.1460S ribosomal protein L27a-3 OS=Arabidopsis thalia... [more]
RL27A_TETTH4.121e-1761.4360S ribosomal protein L27a OS=Tetrahymena thermoph... [more]
RL27A_OSCBR1.015e-1554.4160S ribosomal protein L27a OS=Oscheius brevesophag... [more]
RL27A_DICDI5.038e-1547.9560S ribosomal protein L27a OS=Dictyostelium discoi... [more]
RL27A_EUPCR1.914e-1452.7860S ribosomal protein L27a OS=Euplotes crassus GN=... [more]
RL27A_RAT4.265e-1451.3960S ribosomal protein L27a OS=Rattus norvegicus GN... [more]
RL27A_PONAB4.265e-1451.3960S ribosomal protein L27a OS=Pongo abelii GN=RPL2... [more]
RL27A_PANTR4.265e-1451.3960S ribosomal protein L27a OS=Pan troglodytes GN=R... [more]
RL27A_MACFA4.265e-1451.3960S ribosomal protein L27a OS=Macaca fascicularis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06G13_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06G13, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834949 ID=CF834949|Name=CF834949|organism=Citrus sinensis|type=EST|length=409bp
TTTTTTTTTTCCTTTAAATAGANAATCCAAATCATTCATAAACCTTATTT
GCCCTAGAGGGTGACAAGCAGAAATAACCAGAAAGGCTGAATTTGCGGTA
TCCAGGCTTTCAACAATTACAAAAAGAAGTTTGATCATTAATATCTAAAG
AAATAACAGTTGGTTGTTCAATTGAACCTTTTGGTGAGACAGGAAAAATT
TCATCGGCTGTCTTGGAAACAAGCTTGGCCTTCACCACAACGGGTTGGTT
CTCAGGCAAAACGCCCTTACCCAAAACCTTAAAGTAGCCAAACTGAGTCA
CATCGATCATTGGCACATTGTCTTTGGAAGCCTTGGCTTTGACCTCCTGA
GGTACCATCGACCAAAGCTTGTCGACGTTCACAATTGGGCAATGAAATTT
ATTACGCAG
back to top