CF834955

Overview
NameCF834955
Unique NameCF834955
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length541
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10954 contig Csv1_Contig10954:307..847. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF834955 vs. ExPASy Swiss-Prot
Match: CYPH_CATRO (Peptidyl-prolyl cis-trans isomerase OS=Catharanthus roseus GN=PCKR1 PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 6.680e-40
Identity = 79/92 (85.87%), Postives = 84/92 (91.30%), Query Frame = -1
Query:  266 GGESISG*KFADENFVKKHTGPGILSMANSGPGTTGSQFFVRTAKTEWLDGKHVVFGQLVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 541
            GGESI G KFADENF+KKHTGPGILSMAN+GP T GSQFF+ TAKTEWLDGKHVVFGQ+VEGMDVVKAIEKVGSSSGRT K VV+ DCGQLS
Sbjct:   81 GGESIYGAKFADENFIKKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTAKKVVVEDCGQLS 172          
BLAST of CF834955 vs. ExPASy Swiss-Prot
Match: CYPH_ALLCE (Peptidyl-prolyl cis-trans isomerase OS=Allium cepa GN=CYP PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 1.645e-38
Identity = 75/92 (81.52%), Postives = 82/92 (89.13%), Query Frame = -1
Query:  266 GGESISG*KFADENFVKKHTGPGILSMANSGPGTTGSQFFVRTAKTEWLDGKHVVFGQLVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 541
            GGESI G KF DENF+KKHTGPG+LSMAN+GPGT GSQFF+ T KT WLDGKHVVFGQ+VEGMDVV+AIEKVGS SG+T KPV IADCGQLS
Sbjct:   59 GGESIYGAKFKDENFIKKHTGPGVLSMANAGPGTNGSQFFICTEKTAWLDGKHVVFGQVVEGMDVVRAIEKVGSQSGQTKKPVKIADCGQLS 150          
BLAST of CF834955 vs. ExPASy Swiss-Prot
Match: CYPH_SOLLC (Peptidyl-prolyl cis-trans isomerase OS=Solanum lycopersicum GN=CYP PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 2.807e-38
Identity = 76/91 (83.52%), Postives = 82/91 (90.11%), Query Frame = -1
Query:  269 GGESISG*KFADENFVKKHTGPGILSMANSGPGTTGSQFFVRTAKTEWLDGKHVVFGQLVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 541
            GGESI G KF DENFVKKHTGPGILSMAN+GPGT GSQFF+ TAKTEWL+GKHVVFGQ+VEGMDV+K  E VGSSSGR +KPVVIADCGQL
Sbjct:   81 GGESIYGAKFNDENFVKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCSKPVVIADCGQL 171          
BLAST of CF834955 vs. ExPASy Swiss-Prot
Match: CP18C_ARATH (Peptidyl-prolyl cis-trans isomerase CYP18-3 OS=Arabidopsis thaliana GN=CYP18-3 PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 5.293e-37
Identity = 73/92 (79.35%), Postives = 81/92 (88.04%), Query Frame = -1
Query:  266 GGESISG*KFADENFVKKHTGPGILSMANSGPGTTGSQFFVRTAKTEWLDGKHVVFGQLVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 541
            GGESI G KF DENF +KHTGPGILSMAN+G  T GSQFF+ T KT+WLDGKHVVFGQ+VEG+DVVKAIEKVGSSSG+  KPVV+ADCGQLS
Sbjct:   81 GGESIYGSKFEDENFERKHTGPGILSMANAGANTNGSQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGKPTKPVVVADCGQLS 172          
BLAST of CF834955 vs. ExPASy Swiss-Prot
Match: CP19A_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Arabidopsis thaliana GN=CYP19-1 PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.540e-36
Identity = 72/92 (78.26%), Postives = 81/92 (88.04%), Query Frame = -1
Query:  266 GGESISG*KFADENFVKKHTGPGILSMANSGPGTTGSQFFVRTAKTEWLDGKHVVFGQLVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 541
            GGESI G KF DENF+KKHTGPGILSMAN+G  T GSQFF+ T KT WLDGKHVVFGQ+VEG++VV+ IEKVGS SGRT+KPVVIADCGQ+S
Sbjct:   82 GGESIYGSKFKDENFIKKHTGPGILSMANAGANTNGSQFFICTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDSGRTSKPVVIADCGQIS 173          
BLAST of CF834955 vs. ExPASy Swiss-Prot
Match: CP19B_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Arabidopsis thaliana GN=CYP19-2 PE=1 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.011e-36
Identity = 71/92 (77.17%), Postives = 81/92 (88.04%), Query Frame = -1
Query:  266 GGESISG*KFADENFVKKHTGPGILSMANSGPGTTGSQFFVRTAKTEWLDGKHVVFGQLVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 541
            GGESI G KF DENF +KHTGPGILSMAN+G  T GSQFF+ T KT+WLDGKHVVFGQ+VEG+DVVKAIEK+GSSSG+  KPVVIADCG++S
Sbjct:   82 GGESIYGAKFEDENFERKHTGPGILSMANAGANTNGSQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKIGSSSGKPTKPVVIADCGEIS 173          
BLAST of CF834955 vs. ExPASy Swiss-Prot
Match: CYPH_LUPLU (Peptidyl-prolyl cis-trans isomerase OS=Lupinus luteus PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 3.431e-36
Identity = 70/92 (76.09%), Postives = 82/92 (89.13%), Query Frame = -1
Query:  266 GGESISG*KFADENFVKKHTGPGILSMANSGPGTTGSQFFVRTAKTEWLDGKHVVFGQLVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 541
            G ESI G KFADENF+K+HTGPGILSMAN+G GT GSQFF+ T KTEWLDGKHVVFG+++EGM+VV+ IEKVGS SG+T++PV IADCGQLS
Sbjct:   81 GAESIYGAKFADENFIKRHTGPGILSMANAGAGTNGSQFFICTEKTEWLDGKHVVFGKVIEGMNVVRDIEKVGSGSGKTSRPVTIADCGQLS 172          
BLAST of CF834955 vs. ExPASy Swiss-Prot
Match: CP18D_ARATH (Peptidyl-prolyl cis-trans isomerase CYP18-4 OS=Arabidopsis thaliana GN=CYP18-4 PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 7.643e-36
Identity = 72/92 (78.26%), Postives = 79/92 (85.87%), Query Frame = -1
Query:  266 GGESISG*KFADENFVKKHTGPGILSMANSGPGTTGSQFFVRTAKTEWLDGKHVVFGQLVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 541
            GGESI G KF DENF+KKHTG GILSMANSGP T GSQFF+ T KT WLDGKHVVFGQ+V+G+DVVKAIEKVGS SG+T+K V I DCGQLS
Sbjct:   81 GGESIYGAKFKDENFIKKHTGAGILSMANSGPNTNGSQFFICTDKTSWLDGKHVVFGQVVKGLDVVKAIEKVGSDSGKTSKVVTITDCGQLS 172          
BLAST of CF834955 vs. ExPASy Swiss-Prot
Match: CYPH_BRANA (Peptidyl-prolyl cis-trans isomerase OS=Brassica napus GN=CYP PE=2 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 8.451e-35
Identity = 71/91 (78.02%), Postives = 76/91 (83.52%), Query Frame = -1
Query:  269 GGESISG*KFADENFVKKHTGPGILSMANSGPGTTGSQFFVRTAKTEWLDGKHVVFGQLVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 541
            GGESI G KF DENFVKKHTGPGILSM N+G  T GSQFF+ T KT WLDGKHVVFGQ+VEGMDVV+ IEKVGS SGRT+K VV  DCGQL
Sbjct:   81 GGESIYGMKFKDENFVKKHTGPGILSMRNAGSNTNGSQFFICTEKTSWLDGKHVVFGQVVEGMDVVRDIEKVGSDSGRTSKKVVTCDCGQL 171          
BLAST of CF834955 vs. ExPASy Swiss-Prot
Match: PPIA_PONPY (Peptidyl-prolyl cis-trans isomerase A OS=Pongo pygmaeus GN=PPIA PE=2 SV=4)

HSP 1 Score: 140.969 bits (354), Expect = 3.551e-33
Identity = 64/91 (70.33%), Postives = 79/91 (86.81%), Query Frame = -1
Query:  269 GGESISG*KFADENFVKKHTGPGILSMANSGPGTTGSQFFVRTAKTEWLDGKHVVFGQLVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 541
            GG+SI G KF DENF+ KHTGPGILSMAN+GP T GSQFF+ TAKTEWLDGKHVVFG++ EGM++V+A+E+ GS +G+T+K + IADCGQL
Sbjct:   74 GGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
The following BLAST results are available for this feature:
BLAST of CF834955 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 188
Match NameE-valueIdentityDescription
CYPH_CATRO6.680e-4085.87Peptidyl-prolyl cis-trans isomerase OS=Catharanthu... [more]
CYPH_ALLCE1.645e-3881.52Peptidyl-prolyl cis-trans isomerase OS=Allium cepa... [more]
CYPH_SOLLC2.807e-3883.52Peptidyl-prolyl cis-trans isomerase OS=Solanum lyc... [more]
CP18C_ARATH5.293e-3779.35Peptidyl-prolyl cis-trans isomerase CYP18-3 OS=Ara... [more]
CP19A_ARATH1.540e-3678.26Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Ara... [more]
CP19B_ARATH2.011e-3677.17Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Ara... [more]
CYPH_LUPLU3.431e-3676.09Peptidyl-prolyl cis-trans isomerase OS=Lupinus lut... [more]
CP18D_ARATH7.643e-3678.26Peptidyl-prolyl cis-trans isomerase CYP18-4 OS=Ara... [more]
CYPH_BRANA8.451e-3578.02Peptidyl-prolyl cis-trans isomerase OS=Brassica na... [more]
PPIA_PONPY3.551e-3370.33Peptidyl-prolyl cis-trans isomerase A OS=Pongo pyg... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06G19_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06G19, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834955 ID=CF834955|Name=CF834955|organism=Citrus sinensis|type=EST|length=541bp
TTTTTTTTTTTAAAAAGGATACGGAATATAACAAGACAAGCCCCTTTTTA
TTTAAAAAGGCAGCTCATAGAAAGACATAAAAACCCTTTCATCGAGAACC
ACCACCGGAGACCCGATCCGACCCGAACAAGTAACATAGCAGGAAAATTA
GATAAAGATTAAAAGTCCTACAGACACGCCCACATAATAATAGATAACGT
AGTCAGCATCACGATCGCGATCAGACGGCTCGTGATGATGGCGATCATTA
TCATGATCAAATCTAAGACAATTGACCGCAATCAGCGATCACGACGGGCT
TGTTGGTCCTGCCGGAGCTGGACCCCACTTTCTCGATGGCCTTGACGACG
TCCATCCCTTCGACGAGCTGACCGAACACAACGTGCTTCCCATCGAGCCA
CTCGGTCTTGGCCGTGCGGACGAAGAACTGAGATCCGGTGGTTCCGGGTC
CGGAATTCGCCATGGAAAGGATTCCGGGGCCGGTGTGCTTCTTCACGAAG
TTCTCATCGGCGAATTTCTAGCCGGAGATTGATTCGCCTCC
back to top