CF834959

Overview
NameCF834959
Unique NameCF834959
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length664
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig539 contig Csv1_Contig539:46..685. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF834959 vs. ExPASy Swiss-Prot
Match: H33_VITVI (Histone H3.3 OS=Vitis vinifera PE=2 SV=3)

HSP 1 Score: 229.565 bits (584), Expect = 1.157e-59
Identity = 119/136 (87.50%), Postives = 119/136 (87.50%), Query Frame = 1
Query:   46 MAPTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHXXXXXXXXXXXXXXXXFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 453
            MA TKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSH                FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of CF834959 vs. ExPASy Swiss-Prot
Match: H33_TOBAC (Histone H3.3 OS=Nicotiana tabacum GN=H3 PE=1 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.157e-59
Identity = 119/136 (87.50%), Postives = 119/136 (87.50%), Query Frame = 1
Query:   46 MAPTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHXXXXXXXXXXXXXXXXFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 453
            MA TKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSH                FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of CF834959 vs. ExPASy Swiss-Prot
Match: H33_PINPS (Histone H3.3 OS=Pinus pinaster PE=2 SV=3)

HSP 1 Score: 229.565 bits (584), Expect = 1.157e-59
Identity = 119/136 (87.50%), Postives = 119/136 (87.50%), Query Frame = 1
Query:   46 MAPTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHXXXXXXXXXXXXXXXXFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 453
            MA TKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSH                FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of CF834959 vs. ExPASy Swiss-Prot
Match: H33_ORYSJ (Histone H3.3 OS=Oryza sativa subsp. japonica GN=H3 PE=2 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 1.157e-59
Identity = 119/136 (87.50%), Postives = 119/136 (87.50%), Query Frame = 1
Query:   46 MAPTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHXXXXXXXXXXXXXXXXFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 453
            MA TKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSH                FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of CF834959 vs. ExPASy Swiss-Prot
Match: H33_ORYSI (Histone H3.3 OS=Oryza sativa subsp. indica GN=OsI_011536 PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.157e-59
Identity = 119/136 (87.50%), Postives = 119/136 (87.50%), Query Frame = 1
Query:   46 MAPTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHXXXXXXXXXXXXXXXXFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 453
            MA TKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSH                FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of CF834959 vs. ExPASy Swiss-Prot
Match: H33_ORYCO (Histone H3.3 OS=Oryza coarctata PE=2 SV=3)

HSP 1 Score: 229.565 bits (584), Expect = 1.157e-59
Identity = 119/136 (87.50%), Postives = 119/136 (87.50%), Query Frame = 1
Query:   46 MAPTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHXXXXXXXXXXXXXXXXFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 453
            MA TKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSH                FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of CF834959 vs. ExPASy Swiss-Prot
Match: H33_MEDSA (Histone H3.3 OS=Medicago sativa PE=1 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 1.157e-59
Identity = 119/136 (87.50%), Postives = 119/136 (87.50%), Query Frame = 1
Query:   46 MAPTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHXXXXXXXXXXXXXXXXFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 453
            MA TKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSH                FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of CF834959 vs. ExPASy Swiss-Prot
Match: H33_LOLTE (Histone H3.3 OS=Lolium temulentum PE=2 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 1.157e-59
Identity = 119/136 (87.50%), Postives = 119/136 (87.50%), Query Frame = 1
Query:   46 MAPTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHXXXXXXXXXXXXXXXXFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 453
            MA TKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSH                FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of CF834959 vs. ExPASy Swiss-Prot
Match: H33_LOLMU (Histone H3.3 OS=Lolium multiflorum GN=RH3 PE=2 SV=3)

HSP 1 Score: 229.565 bits (584), Expect = 1.157e-59
Identity = 119/136 (87.50%), Postives = 119/136 (87.50%), Query Frame = 1
Query:   46 MAPTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHXXXXXXXXXXXXXXXXFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 453
            MA TKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSH                FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of CF834959 vs. ExPASy Swiss-Prot
Match: H33_GOSHI (Histone H3.3 OS=Gossypium hirsutum GN=HIS3 PE=2 SV=3)

HSP 1 Score: 229.565 bits (584), Expect = 1.157e-59
Identity = 119/136 (87.50%), Postives = 119/136 (87.50%), Query Frame = 1
Query:   46 MAPTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHXXXXXXXXXXXXXXXXFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 453
            MA TKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSH                FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
The following BLAST results are available for this feature:
BLAST of CF834959 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 211
Match NameE-valueIdentityDescription
H33_VITVI1.157e-5987.50Histone H3.3 OS=Vitis vinifera PE=2 SV=3[more]
H33_TOBAC1.157e-5987.50Histone H3.3 OS=Nicotiana tabacum GN=H3 PE=1 SV=1[more]
H33_PINPS1.157e-5987.50Histone H3.3 OS=Pinus pinaster PE=2 SV=3[more]
H33_ORYSJ1.157e-5987.50Histone H3.3 OS=Oryza sativa subsp. japonica GN=H3... [more]
H33_ORYSI1.157e-5987.50Histone H3.3 OS=Oryza sativa subsp. indica GN=OsI_... [more]
H33_ORYCO1.157e-5987.50Histone H3.3 OS=Oryza coarctata PE=2 SV=3[more]
H33_MEDSA1.157e-5987.50Histone H3.3 OS=Medicago sativa PE=1 SV=2[more]
H33_LOLTE1.157e-5987.50Histone H3.3 OS=Lolium temulentum PE=2 SV=2[more]
H33_LOLMU1.157e-5987.50Histone H3.3 OS=Lolium multiflorum GN=RH3 PE=2 SV=... [more]
H33_GOSHI1.157e-5987.50Histone H3.3 OS=Gossypium hirsutum GN=HIS3 PE=2 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06G23_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06G23, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834959 ID=CF834959|Name=CF834959|organism=Citrus sinensis|type=EST|length=664bp
TTCAGATCTGCCCTTTTTGCAGTTTGTGTTGGTGATTAAAGAGTAATGGC
CCCTACGAAGCAAACCGCGCGCAAGTCAACTGGAGGAAAGGCTCCGAGGA
AGCAGCTCGCCACAAAGGCTGCAAGAAAATCTGCTCCAACAACTGGTGGA
GTCAAGAAGCCCCATCGTTACCGTCCAGGAACTGTCGCCCTACGTGAAAT
CCGCAAATATCAAAAGAGCACTGAGCTTTTGATCCGCAAGCTGCCTTTCC
AGCGGCTGGTTCGTGAAATTGCTCAAGATTTCAAGACAGATTTGAGGTTC
CAAAGCCACGCGGTTCTTGCGCTGCAGGAAGCGGCAGAGGCTTATCTCCT
GGGTCTGTTCGAGGACACCAACCTTTGTGCTATCCATGCCAAGCGAGTCA
CCATTATGCCCAAGGATATTCAACTGGCAAGGCGAATCCGAGGCGAGCGT
GCTTAATTTGTGATTCCTTAGGTAGTCGTCAGTTTCCTATTTAGTTTGCT
AGTTTTTCTTTATTTCGGTTTTTACATGTAAAGAATGATATGATGGATTG
AAGAATATTTGGCATTTGATATTTGCTAGATAAATGTTTATTGTGGAGCT
TATCTTGTTTCACTTTACCTTCATCGGTGGTTTTAAGGACTTGCGTGTAT
GGATTTTCGGCAAT
back to top