CF835074

Overview
NameCF835074
Unique NameCF835074
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length685
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835074 vs. ExPASy Swiss-Prot
Match: PDI2_CAEEL (Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.688e-14
Identity = 39/95 (41.05%), Postives = 59/95 (62.11%), Query Frame = 2
Query:  398 SEAQVLSRAQRIVVELNTENWKKVTEGNEFVLVLGYAPWCPRSAELMPQFAEAATLLKELKCPILMAKLDADRYPKAAAALEIKGFPTLLFFVNG 682
            + A V+   + ++V L  +N+ +V  GNEF+LV  YAPWC     L P++A+AAT LKE    I + KLDA  + + ++  E++G+PTL  F NG
Sbjct:   14 ASAAVIEEEENVIV-LTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNG 107          
BLAST of CF835074 vs. ExPASy Swiss-Prot
Match: PDI1_CAEEL (Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.743e-13
Identity = 37/83 (44.58%), Postives = 52/83 (62.65%), Query Frame = 2
Query:  434 VVELNTENWKKVTEGNEFVLVLGYAPWCPRSAELMPQFAEAATLLKELKCPILMAKLDADRYPKAAAALEIKGFPTLLFFVNG 682
            V+ L   N+++   GNEFVLV  YAPWC     L P++ EAA LLKE    I +AK+DA      A+  E++G+PT+L+F +G
Sbjct:   25 VLVLTESNFEETINGNEFVLVKFYAPWCVHCKSLAPKYDEAADLLKEEGSDIKLAKVDATENQALASKFEVRGYPTILYFKSG 107          
BLAST of CF835074 vs. ExPASy Swiss-Prot
Match: PDI_DROME (Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.606e-12
Identity = 38/96 (39.58%), Postives = 59/96 (61.46%), Query Frame = 2
Query:  398 SEAQVLSRAQRIVVELNTENWKKVTEGNEFVLVLGYAPWCPRSAELMPQFAEAATLLKELKCPILMAKLDADRYPKAAAALEIKGFPTLLFFVNGT 685
            +EA+V  + +  V+    +N+K++   NEFVLV  YAPWC     L P++A+AA  L E + PI +AK+DA    + A    ++G+PTL FF +G+
Sbjct:   19 AEAEV--KVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGS 112          
The following BLAST results are available for this feature:
BLAST of CF835074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
PDI2_CAEEL2.688e-1441.05Protein disulfide-isomerase 2 OS=Caenorhabditis el... [more]
PDI1_CAEEL1.743e-1344.58Protein disulfide-isomerase 1 OS=Caenorhabditis el... [more]
PDI_DROME5.606e-1239.58Protein disulfide-isomerase OS=Drosophila melanoga... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06J24_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06J24, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835074 ID=CF835074; Name=CF835074; organism=Citrus sinensis; type=EST; length=685bp
CGTCCATAACCCTATTAGTTTCTTTGACTGTCGACAGCTCCCCTTGTATC
TCCTTTTCGCATTGTTTTAGTTAAAAATCTTTTCACGCAAAACCCTCACA
AGTCCAGATCTCTTATTGAATCTCACTGCATATTCTCAAGTACCCAGAAA
TCAAAATCACTCGGTTTCCATGTTTCCCGCAAAACCCACTTCAAGATTCA
TCCTTTTCACCCTCTCTCTCCTTCTACTCATCTCATTCTTCACCACCACC
ACCATTGCCATTGCCTCTGATCTTGACACTGAAAATGGTAATGATAACGA
TGACGTGGATAATGAACTTGATGAGTTACTAGCAATTGATCAAGAAGAGC
AAGAACATGAACAAGATTCTCAAGTGGATGATGCGGACTCGAAATTCTCT
GAGGCACAGGTGCTGTCAAGGGCACAGAGGATAGTTGTTGAGTTGAACAC
AGAGAATTGGAAAAAGGTTACTGAAGGGAATGAGTTTGTTCTGGTTCTTG
GATATGCCCCTTGGTGTCCAAGGAGTGCTGAGCTCATGCCTCAGTTTGCT
GAGGCTGCTACTTTGCTTAAGGAATTGAAATGTCCTATTTTGATGGCTAA
GCTTGACGCTGATAGATACCCCAAGGCTGCTGCTGCACTTGAGATCAAAG
GGTTCCCTACTTTGCTCTTTTTCGTCAATGGCACC
back to top