CF835084

Overview
NameCF835084
Unique NameCF835084
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length719
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835084 vs. ExPASy Swiss-Prot
Match: NEP2_NEPGR (Aspartic proteinase nepenthesin-2 OS=Nepenthes gracilis GN=nep2 PE=1 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 3.087e-40
Identity = 87/223 (39.01%), Postives = 117/223 (52.47%), Query Frame = 2
Query:    2 DTGSDINWLQCRPCTECYQQSDPIFDPKTSSSYSPLPCAAPQCKSLDVSACRANRCLYQVAYGDGSYTVGDLVTETVSFGNSGSVKGIALGCGHDNE-XXXXXXXXXXXXXXXXXXXTKQIKAMSLAYCLVDRDSPASGVLEFNSARGGDAVTAP---LIRNKKVDTFYYVGLTGFSVGGQAVQIPPSLFEMDEAGDGGIIVDCGTAITRLQTQAYNSLRDSF 658
            DTGSD+ W QC PCT+C+ Q  PIF+P+ SSS+S LPC +  C+ L    C  N C Y   YGDGS T G + TET +F  S SV  IA GCG DN+                      Q+     +YC+    S +   L   SA  G    +P   LI +    T+YY+ L G +VGG  + IP S F++ + G GG+I+D GT +T L   AYN++  +F
Sbjct:  114 DTGSDLIWTQCEPCTQCFSQPTPIFNPQDSSSFSTLPCESQYCQDLPSETCNNNECQYTYGYGDGSTTQGYMATETFTFETS-SVPNIAFGCGEDNQGFGQGNGAGLIGMGWGPLSLPSQLGVGQFSYCMTSYGSSSPSTLALGSAASGVPEGSPSTTLIHSSLNPTYYYITLQGITVGGDNLGIPSSTFQLQDDGTGGMIIDSGTTLTYLPQDAYNAVAQAF 335          
BLAST of CF835084 vs. ExPASy Swiss-Prot
Match: NEP1_NEPGR (Aspartic proteinase nepenthesin-1 OS=Nepenthes gracilis GN=nep1 PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.001e-39
Identity = 94/246 (38.21%), Postives = 134/246 (54.47%), Query Frame = 2
Query:    2 DTGSDINWLQCRPCTECYQQSDPIFDPKTSSSYSPLPCAAPQCKSLDVSACRANRCLYQVAYGDGSYTVGDLVTETVSFGNSGSVKGIALGCGHDNE-XXXXXXXXXXXXXXXXXXXTKQIKAMSLAYCL--VDRDSPASGVLE--FNSARGGDAVTAPLIRNKKVDTFYYVGLTGFSVGGQAVQIPPSLFEMD-EAGDGGIIVDCGTAITRLQTQAYNSLRDSFVRLAGNLKPTSGVAL-FDTCY 718
            DTGSD+ W QC+PCT+C+ QS PIF+P+ SSS+S LPC++  C++L    C  N C Y   YGDGS T G + TET++FG S S+  I  GCG +N+                      Q+     +YC+  +   +P++ +L    NS   G   T  LI++ ++ TFYY+ L G SVG   + I PS F ++   G GGII+D GT +T     AY S+R  F+    NL   +G +  FD C+
Sbjct:  113 DTGSDLIWTQCQPCTQCFNQSTPIFNPQGSSSFSTLPCSSQLCQALSSPTCSNNFCQYTYGYGDGSETQGSMGTETLTFG-SVSIPNITFGCGENNQGFGQGNGAGLVGMGRGPLSLPSQLDVTKFSYCMTPIGSSTPSNLLLGSLANSVTAGSPNTT-LIQSSQIPTFYYITLNGLSVGSTRLPIDPSAFALNSNNGTGGIIIDSGTTLTYFVNNAYQSVRQEFISQI-NLPVVNGSSSGFDLCF 355          
The following BLAST results are available for this feature:
BLAST of CF835084 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
NEP2_NEPGR3.087e-4039.01Aspartic proteinase nepenthesin-2 OS=Nepenthes gra... [more]
NEP1_NEPGR2.001e-3938.21Aspartic proteinase nepenthesin-1 OS=Nepenthes gra... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06K06_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06K06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835084 ID=CF835084; Name=CF835084; organism=Citrus sinensis; type=EST; length=719bp
CGACACCGGCAGTGACATTAACTGGCTTCAGTGCCGGCCTTGTACCGAGT
GTTATCAACAATCCGATCCGATTTTTGACCCAAAAACGTCATCGTCTTAC
AGTCCTCTCCCGTGTGCCGCTCCTCAGTGTAAATCCCTCGACGTGTCCGC
TTGTCGTGCGAACAGGTGCCTCTACCAAGTGGCGTACGGTGATGGATCTT
ATACCGTGGGTGATTTGGTGACTGAAACGGTGTCGTTTGGAAACAGCGGG
AGCGTGAAGGGTATCGCTTTGGGTTGCGGTCATGATAATGAAGGGCTCTT
TGTTGGATCTGCCGGCTTGCTTGGACTTGGGGGTGGCATGCTCTCTCTTA
CTAAGCAAATTAAAGCGATGTCATTGGCATACTGCTTGGTGGACCGTGAC
TCTCCCGCCTCTGGTGTTCTCGAGTTCAACTCGGCACGAGGCGGTGACGC
GGTCACGGCTCCGTTGATTAGGAACAAAAAAGTTGACACGTTCTATTACG
TGGGGCTCACTGGATTCAGCGTCGGTGGTCAGGCGGTCCAAATCCCACCA
TCGCTTTTTGAAATGGACGAAGCAGGCGACGGCGGGATTATTGTTGATTG
TGGAACCGCCATAACTCGCCTGCAGACTCAGGCCTACAACTCGCTCCGCG
ACTCTTTCGTCAGGCTGGCGGGTAACTTGAAACCCACCAGCGGGGTCGCT
TTATTCGACACGTGCTACG
back to top