CF835089

Overview
NameCF835089
Unique NameCF835089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length666
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835089 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.601e-16
Identity = 51/138 (36.96%), Postives = 74/138 (53.62%), Query Frame = -2
Query:  183 CPLDVIQLSSPSERGDNLRLLPYDNYK-IVKVSTDVNLRFPVKVSVKPCNEEPLWKVDSYDDPL----IVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRCNKIGVSTKDGVRRLLLVGDHE 581
            CP  V+Q  S  + G  +     D+   +V+VSTDVN+ F V +  + C+   +W++D+YD+      + T G +G PG  TL +WFKIEKAG       Y    CPSVC SC   C+ IG  + D  +  L + D+E
Sbjct:   69 CPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEF-VPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVLG----YKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLALSDNE 201          
BLAST of CF835089 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 83.5741 bits (205), Expect = 1.025e-15
Identity = 49/139 (35.25%), Postives = 73/139 (52.52%), Query Frame = -2
Query:  189 CPLDVIQLSSPSERGDNLRLLPYDNYK--IVKVSTDVNLRFPVKVSVKPCN--EEPLWKVDSYDDP----LIVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRCNKIGVSTKDGVRRLLLVGD 581
            CP  V+Q     +    L   P +N K  +V+VSTD+N+ F    +  PC      +W++D YD+      +  GG +G+PG ET+ +WFKIE+   F   G Y +V CP+VC SC  +C  +G+      RR L + D
Sbjct:   76 CPPRVVQTRKEVDHDRPLAFFP-ENPKEDVVRVSTDLNINFS---AFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEE---FCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSD 207          
The following BLAST results are available for this feature:
BLAST of CF835089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
ASP_THECC4.601e-1636.9621 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU1.025e-1535.25Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06K12_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06K12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835089 ID=CF835089; Name=CF835089; organism=Citrus sinensis; type=EST; length=666bp
TTCTGGAATAGAGATAAAAGGTTACTCCCTTGGGCTATTATTTAGAATGA
TACAGCTAAGTTCATTCATTACGCGGTCATTGATATTGCTTCAGCAGCTT
CAAAAAACCTTGATATTGCGTTAGCAGCTTGAAGTAGCCTTGAGCTTTCC
TCTGATGGAAAAAACAGAACATTCAAAGCCGGTTCATGATCACCAACTAG
AAGCAGACGTCGAACGCCATCCTTAGTTGAAACGCCAATTTTGTTGCAGC
GTCTAGGACAAGATAGACAGACACTCGGACAATGGACAATATTGTATACA
CCACCATATGAAAAATTTCCAGCTTTCTCAATCTTAAACCAATTTAGCAA
CGTTTCAGCTCCTGGGTGGCCCTCACTTCCGCCGGTTACAATTAATGGAT
CGTCATAGCTATCAACTTTCCACAATGGTTCTTCATTACAGGGCTTAACA
GAAACTTTTACGGGGAATCTCAGGTTGACATCAGTGGATACCTTGACAAT
TTTGTAATTGTCGTACGGAAGTAATCTTAAATTATCTCCCCTTTCGCTAG
GAGAACTTAATTGGATAACGTCCAAGGGACACCTGTCCATTTGTGCCTAG
GTGTGTGCTGAATCCACCGGCGCCATCTAGGACTGGGATAAGTTTATACT
CGAGGGTGGATTTGAC
back to top