CF835094

Overview
NameCF835094
Unique NameCF835094
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length614
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835094 vs. ExPASy Swiss-Prot
Match: RHA2A_ARATH (RING-H2 zinc finger protein RHA2a OS=Arabidopsis thaliana GN=RHA2A PE=1 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 5.670e-23
Identity = 50/82 (60.98%), Postives = 59/82 (71.95%), Query Frame = -3
Query:  340 CGQGVASSAAGSDCMVCLCTLRDGELVRKLDCRHVFHKDCLDGWLHHLNFNCPLC*SPVVSEERVWNTRRRVGGDLIQWFSL 585
            CG G      GSDC+VCL  L++GE VRKL+CRHVFHK CL+GWLH  NF CPLC S +VS++ V  T+R VG DLI  FSL
Sbjct:   76 CGDG---GGGGSDCVVCLSKLKEGEEVRKLECRHVFHKKCLEGWLHQFNFTCPLCRSALVSDDCVSKTQRSVGRDLISCFSL 154          
BLAST of CF835094 vs. ExPASy Swiss-Prot
Match: RHA2B_ARATH (RING-H2 zinc finger protein RHA2b OS=Arabidopsis thaliana GN=RHA2B PE=1 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 2.465e-18
Identity = 39/54 (72.22%), Postives = 44/54 (81.48%), Query Frame = -3
Query:  406 SSAAGSDCMVCLCTLRDGELVRKLDCRHVFHKDCLDGWLHHLNFNCPLC*SPVV 567
            S  A SDC+VCL  L+ GE VRKLDCRHVFHK CL+GWL HLNFNCPLC SP++
Sbjct:   67 SDNAASDCIVCLSKLKTGEEVRKLDCRHVFHKQCLEGWLQHLNFNCPLCRSPLL 120          
The following BLAST results are available for this feature:
BLAST of CF835094 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
RHA2A_ARATH5.670e-2360.98RING-H2 zinc finger protein RHA2a OS=Arabidopsis t... [more]
RHA2B_ARATH2.465e-1872.22RING-H2 zinc finger protein RHA2b OS=Arabidopsis t... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06K15_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06K15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835094 ID=CF835094; Name=CF835094; organism=Citrus sinensis; type=EST; length=614bp
TTTTTTTTTTTAGAAAACAAAAAAAGATGGAAAATTTACAGCCCCTTAAG
AACCCCAAAGAGCTCCAAAAAAATTCTCAAAAAAATCTTTTTAAAAAAAA
ACTAAAATTCCTAAAAATTCTAAACTAATCAACCAAAAAAAGAAAGGAAG
AAAGAAAGCGTATGGTCGAAACTACCACCAACTCTCTAAAATCAAAAGGT
TAAAGAAAAAGATTATAGCTAAAAATGAAAATCACCACCAGCATCAACCA
TCAAAGAGAATCATGGGGGGTGGCGGATGCATCATTGAACCATCAAAACC
AATATGCAATCATGGAGATGCTTCTGATGTACATTAACGCAAGGAGAACC
ACTGAATCAAATCCCCGCCGACTCGCCTCCGCGTGTTCCAGACGCGCTCT
TCGGAAACAACCGGCGATCAGCAAAGCGGACAGTTAAAATTGAGATGATG
AAGCCAGCCGTCAAGGCAATCCTTGTGAAACACGTGGCGGCAGTCGAGCT
TCCTAACGAGCTCGCCATCTCTTAGCGTGCACAAGCACACCATGCAATCA
CTACCGGCAGCGCTACTTGCCACCCCCTGACCGCAGCAACAATTATCATT
GATTTTATTAATAT
back to top