CF835201

Overview
NameCF835201
Unique NameCF835201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length661
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835201 vs. ExPASy Swiss-Prot
Match: METL5_HUMAN (Methyltransferase-like protein 5 OS=Homo sapiens GN=METTL5 PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.400e-41
Identity = 95/186 (51.08%), Postives = 117/186 (62.90%), Query Frame = 2
Query:   56 LEQYPTGPHIASRMLYTAENSFGDVSNKVVADFXXXXXXXXXXXXXXXXDQVIAIDIDSDSLELASENAADLEL-DIDFVQCDIRNLEWRVCSVGHVDTVVMNPPFGTR-KKGVDMDFLSMALKVASQAVYSLHKTSTREHVKKAALRDFNASSAEVLCELRYDVPQLYKFHKKKEVDIAVDLWRF 607
            LEQYPT PHIA+ MLYT  N++ D+ NKVVAD                    +  DID D+LE+ + NA + EL +ID VQCD+  L  R+      DTV+MNPPFGT+  KG DM FL  AL++A  AVYSLHK+STREHV+K A         +++ ELRYD+P  YKFHKKK VDI VDL RF
Sbjct:   26 LEQYPTRPHIAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDEDALEIFNRNAEEFELTNIDMVQCDVCLLSNRMSK--SFDTVIMNPPFGTKNNKGTDMAFLKTALEMARTAVYSLHKSSTREHVQKKAAE--WKIKIDIIAELRYDLPASYKFHKKKSVDIEVDLIRF 207          
BLAST of CF835201 vs. ExPASy Swiss-Prot
Match: METL5_MOUSE (Methyltransferase-like protein 5 OS=Mus musculus GN=Mettl5 PE=2 SV=2)

HSP 1 Score: 167.933 bits (424), Expect = 4.094e-41
Identity = 91/186 (48.92%), Postives = 117/186 (62.90%), Query Frame = 2
Query:   56 LEQYPTGPHIASRMLYTAENSFGDVSNKVVADFXXXXXXXXXXXXXXXXDQVIAIDIDSDSLELASENAADLEL-DIDFVQCDIRNLEWRVCSVGHVDTVVMNPPFGTRK-KGVDMDFLSMALKVASQAVYSLHKTSTREHVKKAALRDFNASSAEVLCELRYDVPQLYKFHKKKEVDIAVDLWRF 607
            LEQYPT PHIA+ MLYT  N++ D+ NK VAD                    +  DID D+LE+ ++N  + EL ++D +QCD+ +L  R+  +   DTV+MNPPFGT+  KG DM FL  AL +A  AVYSLHK+STREH++K A         E++ ELRYD+P LY FHKKK VDI VDL RF
Sbjct:   26 LEQYPTRPHIAACMLYTIHNTYDDIENKAVADLGCGCGVLSIGAAMLGAGLCVGFDIDEDALEIFNKNVEEFELTNVDMIQCDVYSLSNRMSKL--FDTVIMNPPFGTKNNKGTDMAFLKTALGMARTAVYSLHKSSTREHIQKKAAEW--KVKIEIIAELRYDLPALYNFHKKKSVDIEVDLIRF 207          
BLAST of CF835201 vs. ExPASy Swiss-Prot
Match: Y284_METJA (Uncharacterized protein MJ0284 OS=Methanocaldococcus jannaschii GN=MJ0284 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 6.361e-18
Identity = 62/189 (32.80%), Postives = 94/189 (49.74%), Query Frame = 2
Query:   56 LEQYPTGPHIASRMLYTAENSFGDVSNKVVADFXXXXXXXXXXXXXXXXDQVIAIDIDSDSLELASENAADLELDIDFVQCDIRNLEWRVCS--VGH----VDTVVMNPPFGTRKKGVDMDFLSMALKVASQAVYSLHKTSTREHVKKAALRDFNASSAEVLCELRYDVPQLYKFHKKKEVDIAVDLWR 604
            LEQY     +A+ +L+ A N F    N VV D                  + I IDID +S+E A ENA  L +D+DF   DIR+++    +  +G        V+ NPPFG +KK  D  FL  AL++    +Y++H   T++ V K    +        + E  + +P +Y+FHKKK V+I V ++R
Sbjct:   24 LEQYTIDGKLAADILFFAVNDF---YNNVVIDLGCGTGRLAIGSKILGAKRAIGIDIDRESIEAAKENAKKLNVDVDFYCMDIRDVDDEFLNNVLGEDRDLKRVVIQNPPFGAQKKHADRVFLDKALEI-GDIIYTIHNYPTKDFVIKYV--EDKGGKITHIYEAFFRIPAIYEFHKKKVVEIPVVIFR 206          
The following BLAST results are available for this feature:
BLAST of CF835201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
METL5_HUMAN2.400e-4151.08Methyltransferase-like protein 5 OS=Homo sapiens G... [more]
METL5_MOUSE4.094e-4148.92Methyltransferase-like protein 5 OS=Mus musculus G... [more]
Y284_METJA6.361e-1832.80Uncharacterized protein MJ0284 OS=Methanocaldococc... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06N10_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06N10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835201 ID=CF835201; Name=CF835201; organism=Citrus sinensis; type=EST; length=661bp
CAACTAGAAACCGTTTTGGGTGACCTCNAGCAGTTCTCCAATCCGATAGG
TGGCCTTGGAGCAGTATCCAACTGGACCCCACATAGCCTCTCGTATGCTT
TACACTGCGGAAAATTCATTTGGTGATGTGAGCAATAAGGTAGTGGCAGA
TTTTGGCTGCGGGTGTGGTACATTAGGGGCTGCAGCTACTCTCTTGGGTG
CAGATCAGGTTATTGCTATTGATATTGATTCTGATTCTCTTGAGTTAGCA
TCAGAAAATGCTGCGGATCTTGAGTTGGACATAGATTTTGTTCAGTGTGA
CATCAGGAACCTAGAATGGAGAGTCTGTTCTGTAGGACATGTTGACACTG
TCGTAATGAATCCTCCATTTGGAACACGGAAAAAGGGGGTTGACATGGAT
TTTCTCTCTATGGCTTTGAAGGTTGCTTCTCAAGCAGTCTATTCCTTGCA
TAAGACGTCTACAAGAGAACATGTGAAAAAGGCAGCACTCCGAGACTTCA
ATGCTAGTAGTGCTGAGGTGTTGTGTGAGCTTCGATATGATGTTCCACAA
CTATACAAATTTCATAAGAAAAAGGAGGTGGATATTGCTGTGGATCTTTG
GCGATTTGTGCCCAAAAGAAATCTGGGAAGGGGTATTTAACACTTGTGTC
GGGAGTATGCT
back to top