CF835208

Overview
NameCF835208
Unique NameCF835208
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length725
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835208 vs. ExPASy Swiss-Prot
Match: NEP1_NEPGR (Aspartic proteinase nepenthesin-1 OS=Nepenthes gracilis GN=nep1 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.757e-18
Identity = 56/172 (32.56%), Postives = 85/172 (49.42%), Query Frame = -3
Query:  190 TPLLKNPRRSSLYYVNLLAIRVGRRVVDIPPGALQFNPTTGAG-TIIDSGTVFTRLVAPAYTAVRDVFRRRVGSNLTVTSLGGFDTCYSVP-----IVAPTITLMFSGMNVTLPQDNLLIHSTAGSITCLAMAAAPDNVNSVLNVIANMQQQNHRILYDVPNSRLGVARELC 687
            T L+++ +  + YY+ L  + VG   + I P A   N   G G  IIDSGT  T  V  AY +VR  F  ++   +   S  GFD C+  P     +  PT  + F G ++ LP +N  I S +  + CLAM ++       +++  N+QQQN  ++YD  NS +  A   C
Sbjct:  268 TTLIQSSQIPTFYYITLNGLSVGSTRLPIDPSAFALNSNNGTGGIIIDSGTTLTYFVNNAYQSVRQEFISQINLPVVNGSSSGFDLCFQTPSDPSNLQIPTFVMHFDGGDLELPSENYFI-SPSNGLICLAMGSSSQG----MSIFGNIQQQNMLVVYDTGNSVVSFASAQC 434          
BLAST of CF835208 vs. ExPASy Swiss-Prot
Match: NEP2_NEPGR (Aspartic proteinase nepenthesin-2 OS=Nepenthes gracilis GN=nep2 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 9.190e-16
Identity = 55/179 (30.73%), Postives = 81/179 (45.25%), Query Frame = -3
Query:  190 GQPKRIKYTPLLKNPRRSSLYYVNLLAIRVGRRVVDIPPGALQFNPTTGAGTIIDSGTVFTRLVAPAYTAVRDVFRRRVGSNLTVTSLGGFDTCYSVP-----IVAPTITLMFSGMNVTLPQDNLLIHSTAGSITCLAMAAAPDNVNSVLNVIANMQQQNHRILYDVPNSRLGVARELC 711
            G P+    T L+ +    + YY+ L  I VG   + IP    Q       G IIDSGT  T L   AY AV   F  ++       S  G  TC+  P     +  P I++ F G  + L + N+LI S A  + CLAM ++       +++  N+QQQ  ++LYD+ N  +      C
Sbjct:  261 GVPEGSPSTTLIHSSLNPTYYYITLQGITVGGDNLGIPSSTFQLQDDGTGGMIIDSGTTLTYLPQDAYNAVAQAFTDQINLPTVDESSSGLSTCFQQPSDGSTVQVPEISMQFDGGVLNLGEQNILI-SPAEGVICLAMGSSS---QLGISIFGNIQQQETQVLYDLQNLAVSFVPTQC 435          
The following BLAST results are available for this feature:
BLAST of CF835208 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
NEP1_NEPGR5.757e-1832.56Aspartic proteinase nepenthesin-1 OS=Nepenthes gra... [more]
NEP2_NEPGR9.190e-1630.73Aspartic proteinase nepenthesin-2 OS=Nepenthes gra... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06N14_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06N14, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835208 ID=CF835208; Name=CF835208; organism=Citrus sinensis; type=EST; length=725bp
TTTTTTTTTTTTTTAAAGGTACAAAATAATTTTATTTGGGTCTCACTTTT
AGTCCCCACAATTCCTCCCATAAAAAGTTAATTAGCAATAATGACAAACA
AACCTCACGCGGCTAAAATTACCCATTACAGGACCCACAAGAAAAAGAGA
AAACAAGTACAAACATATCTCACAATTCTATATCTAAGTGCAAAGCTCAC
GGGCGACACCGAGCCTTGAATTGGGCACATCATAGAGGATTCTGTGGTTT
TGTTGCTGCATATTGGCAATGACATTAAGCACTGAGTTGACGTTGTCTGG
AGCTGCAGCCATGGCCAAGCATGTGATGCTCCCTGCAGTGCTGTGGATTA
GAAGGTTGTCTTGTGGTAGAGTCACGTTCATGCCTGAGAACATCAACGTG
ATTGTCGGCGCAACGATTGGGACCGAGTAGCACGTGTCGAATCCGCCTAG
GGATGTCACTGTTAAGTTACTCCCTACACGTCTACGGAACACGTCTCTCA
CTGCGGTGTAAGCTGGCGCCACCAGTCTGGTAAAAACTGTGCCAGAATCA
ATAATAGTGCCAGCGCCGGTTGTGGGATTGAACTGTAAGGCACCAGGTGG
GATATCAACAACTCTTCTGCCAACCCTAATGGCCAACAAATTAACATAGT
AAAGTGATGATCTTCTTGGGTTTTTAAGCAATGGTGTATACTTAATCCGC
TTGGGCTGACCAATGGGTCCTAATC
back to top