CF835317

Overview
NameCF835317
Unique NameCF835317
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length849
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9291 contig Csv1_Contig9291:524..1372. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS2_CITSI (Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 1.368e-112
Identity = 209/234 (89.32%), Postives = 210/234 (89.74%), Query Frame = -2
Query:  147 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIKA 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALF           DPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAP+GISDWNSIFWIAHPGGPAILDQV           KATRQVLSEYGNMSSACVLFILDEMRKKS EEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIKA
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPLGISDWNSIFWIAHPGGPAILDQVESKLGLKGEKLKATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIKA 391          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_RUTGR (Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=2 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 2.261e-107
Identity = 197/234 (84.19%), Postives = 203/234 (86.75%), Query Frame = -2
Query:  147 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIKA 848
            MMY QGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGPADTHLDSLVGQALF           DPD S+ERPLYQLVS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNSIFWIAHPGGPAILDQV           +ATRQVLSEYGNMSSACVLFILDEMRK  AEE +ATTGEGLDWGVLFGFGPGLTVETVVL SVPIKA
Sbjct:  160 MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDESIERPLYQLVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPIGISDWNSIFWIAHPGGPAILDQVEAKLGLKEEKLRATRQVLSEYGNMSSACVLFILDEMRKNCAEEGRATTGEGLDWGVLFGFGPGLTVETVVLRSVPIKA 393          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS2_RUTGR (Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=2 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 8.591e-107
Identity = 196/234 (83.76%), Postives = 203/234 (86.75%), Query Frame = -2
Query:  147 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIKA 848
            MMY QGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGPADTHLDSLVGQALF           DP+ S+ERPLYQLVS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNSIFWIAHPGGPAILDQV           +ATRQVLSEYGNMSSACVLFILDEMRKK AEE +ATTGEGLDWGVLFGFGPGLTVETVVL SVPI A
Sbjct:  160 MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPNESIERPLYQLVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPIGISDWNSIFWIAHPGGPAILDQVEAKLGLKEEKLRATRQVLSEYGNMSSACVLFILDEMRKKCAEEGRATTGEGLDWGVLFGFGPGLTVETVVLRSVPINA 393          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS3_RUTGR (Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=2 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 4.264e-106
Identity = 195/234 (83.33%), Postives = 201/234 (85.90%), Query Frame = -2
Query:  147 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIKA 848
            MMY QGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP DTHLDSLVGQALF           DPD S+ERPLYQLVS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNSIFWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRKK AEE  ATTGEGL+WGVLFGFGPGLTVETVVL SVPIKA
Sbjct:  160 MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPVDTHLDSLVGQALFGDGAAAVIVGADPDESIERPLYQLVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPIGISDWNSIFWIAHPGGPAILDQVEEKLELKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKCAEEGMATTGEGLEWGVLFGFGPGLTVETVVLRSVPIKA 393          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_PETCR (Chalcone synthase OS=Petroselinum crispum GN=CHS PE=3 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 1.620e-105
Identity = 192/231 (83.12%), Postives = 201/231 (87.01%), Query Frame = -2
Query:  156 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 848
            MMY QGCFAGGTVLRLAKDLAENN GARVLVVCSEITAVTFRGP+D+HLDSLVGQALF           DPD SVERPL+QL+S +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATRQVLS+YGNMSSACVLFILDEMRKKS EE KATTGEGLDWGVLFGFGPGLTVETVVLHSVP
Sbjct:  163 MMYQQGCFAGGTVLRLAKDLAENNAGARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVILGSDPDLSVERPLFQLISAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPIGISDWNSLFWIAHPGGPAILDQVELKLGLKEEKMRATRQVLSDYGNMSSACVLFILDEMRKKSIEEGKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 393          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS2_DAUCA (Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 3.610e-105
Identity = 191/231 (82.68%), Postives = 201/231 (87.01%), Query Frame = -2
Query:  156 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 848
            MMY QGCFAGGTVLRLAKDLAENN GARVLVVCSEITAVTFRGP+D+HLDSLVGQALF           DPD SVERPL+QL+S +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATRQVLS+YGNMSSACVLFILDEMRKKS EE KATTG+GLDWGVLFGFGPGLTVETVVLHSVP
Sbjct:  162 MMYQQGCFAGGTVLRLAKDLAENNTGARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVIVGSDPDLSVERPLFQLISAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPIGISDWNSLFWIAHPGGPAILDQVELKLGLKEEKMRATRQVLSDYGNMSSACVLFILDEMRKKSIEEGKATTGDGLDWGVLFGFGPGLTVETVVLHSVP 392          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_BETVE (Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 SV=2)

HSP 1 Score: 379.022 bits (972), Expect = 1.791e-104
Identity = 189/232 (81.47%), Postives = 201/232 (86.64%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVGQALF           DPDTSVERPL++L+S +QTILPDSDGAIDGHLREVGLTFHLLKDVPG+ISKNIEKSL+EAFAP+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMR+ S E  K TTGEGL+WGVLFGFGPGLTVETVVLHSVP+
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLFELISAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLAEAFAPLGISDWNSLFWIAHPGGPAILDQVESKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRRNSLEGGKVTTGEGLEWGVLFGFGPGLTVETVVLHSVPV 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_ARAAL (Chalcone synthase OS=Arabis alpina GN=CHS PE=3 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 7.526e-103
Identity = 188/233 (80.69%), Postives = 203/233 (87.12%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSV-ERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DPDTSV E+P++++VS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRKKSA++  ATTGEGL+WGVLFGFGPGLTVETVVLHSVP+
Sbjct:  159 MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGGPAILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRKKSAKDGAATTGEGLEWGVLFGFGPGLTVETVVLHSVPL 391          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_CALCH (Chalcone synthase OS=Callistephus chinensis GN=CHS PE=2 SV=2)

HSP 1 Score: 372.089 bits (954), Expect = 2.190e-102
Identity = 184/231 (79.65%), Postives = 201/231 (87.01%), Query Frame = -2
Query:  156 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVGQALF           DPD + ERPL++++S +QTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIEK+L++AF+P+GI+DWNSIFWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFI+DEMRKKSAE+  ATTGEGLDWGVLFGFGPGLTVETVVLHS+P
Sbjct:  161 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGADPDLTTERPLFEMISAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALTQAFSPLGITDWNSIFWIAHPGGPAILDQVELKLGLKEEKMRATRHVLSEYGNMSSACVLFIIDEMRKKSAEDGAATTGEGLDWGVLFGFGPGLTVETVVLHSLP 391          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_ORYSJ (Chalcone synthase OS=Oryza sativa subsp. japonica GN=CHS PE=2 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 3.735e-102
Identity = 183/234 (78.21%), Postives = 202/234 (86.32%), Query Frame = -2
Query:  147 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIKA 848
            MMY QGCFAGGTVLR+AKDLAENN+GARVL VCSEITAVTFRGP+++HLDS+VGQALF           DPD +VERPL+Q+VS SQTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIE++L +AF P+GISDWNSIFW+AHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK+SAE+  ATTGEG+DWGVLFGFGPGLTVETVVLHSVPI A
Sbjct:  161 MMYQQGCFAGGTVLRVAKDLAENNRGARVLAVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGSDPDEAVERPLFQMVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERALGDAFTPLGISDWNSIFWVAHPGGPAILDQVEAKVGLDKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGHATTGEGMDWGVLFGFGPGLTVETVVLHSVPITA 394          
The following BLAST results are available for this feature:
BLAST of CF835317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 147
Match NameE-valueIdentityDescription
CHS2_CITSI1.368e-11289.32Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=... [more]
CHS1_RUTGR2.261e-10784.19Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=... [more]
CHS2_RUTGR8.591e-10783.76Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=... [more]
CHS3_RUTGR4.264e-10683.33Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=... [more]
CHSY_PETCR1.620e-10583.12Chalcone synthase OS=Petroselinum crispum GN=CHS P... [more]
CHS2_DAUCA3.610e-10582.68Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 ... [more]
CHSY_BETVE1.791e-10481.47Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 ... [more]
CHSY_ARAAL7.526e-10380.69Chalcone synthase OS=Arabis alpina GN=CHS PE=3 SV=... [more]
CHSY_CALCH2.190e-10279.65Chalcone synthase OS=Callistephus chinensis GN=CHS... [more]
CHSY_ORYSJ3.735e-10278.21Chalcone synthase OS=Oryza sativa subsp. japonica ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A15_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835317 ID=CF835317|Name=CF835317|organism=Citrus sinensis|type=EST|length=849bp
TTTTGACGTCATCAGTGAAAAGGTACGATGCCTTAAATTCAATTGACAAA
ACTAAACCTTCACACGATCAACCAATAATTCAAGAGTGAAAGCATACAAC
ATAAAGTTACTGAACTACTAAACATACTGATGGAGTTCTCACTTCAAGCT
TTGATGGGGACACTGTGCAGCACAACGGTCTCGACGGTGAGCCCCGGCCC
GAACCCGAACAGCACACCCCAATCTAGCCCTTCGCCGGTGGTGGCTTTCG
CTTCCTCAGCAGACTTCTTTCTCATCTCGTCAAGGATGAACAGGACACAA
GCGCTTGACATGTTACCGTACTCACTCAACACTTGACGTGTGGCCTTCAG
CTTCTCCTCTTTGAGGCCGAGTTTAGACTCCACTTGGTCCAGAATTGCGG
GCCCACCGGGGTGAGCGATCCAGAATATCGAGTTCCAGTCGCTGATGCCA
ACCGGGGCGAACGCTTCCGACAGGCTTTTCTCTATATTCTTTGAGATCAA
GCCGGGGACGTCTTTAAGCAAATGGAAAGTGAGACCGACTTCGCGCAAGT
GTCCGTCAATTGCACCGTCAGAGTCAGGGAGGATCGTCTGCGAAGTCGAC
ACAAGCTGATACAACGGACGCTCGACCGACGTGTCAGGATCGGCACCCAC
GATCACAGCAGCAGCACCATCACCGAACAAAGCCTGGCCCACAAGAGAAT
CAAGATGAGTATCGGCAGGGCCGCGGAAAGTGACCGCCGTGATCTCCGAA
CAGACAACAAGAACGCGAGCGCCCTTGTTGTTCTCAGCCAAGTCTTTAGC
GAGGCGAAGAACAGTGCCGCCGGCGAAACATCCTTGNTGGTACATCATG
back to top