CF835318

Overview
NameCF835318
Unique NameCF835318
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length686
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10176 contig Csv1_Contig10176:174..859. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835318 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.598e-17
Identity = 54/152 (35.53%), Postives = 78/152 (51.32%), Query Frame = 3
Query:   18 GAGGFSTHLRTNGQCPLDVIHLSSPSERGDNLRLLPYDNYK-IVKVSTDVNLRFPVKVSVKPCNEEPLWKVDSYDDPL----IVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRCNKIGVSTKDGVRRLLLVGDHE 458
            G GG +    T   CP  V+   S  + G  +     D+   +V+VSTDVN+ F V +  + C+   +W++D+YD+      + T G +G PG  TL +WFKIEKAG       Y    CPSVC SC   C+ IG  + D  +  L + D+E
Sbjct:   55 GGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEF-VPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVLG----YKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLALSDNE 201          
BLAST of CF835318 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 84.7297 bits (208), Expect = 4.899e-16
Identity = 57/161 (35.40%), Postives = 82/161 (50.93%), Query Frame = 3
Query:    6 PVL-DGAGGFSTHLRT-NGQ--CPLDVIHLSSPSERGDNLRLLPYDNYK--IVKVSTDVNLRFPVKVSVKPCN--EEPLWKVDSYDDP----LIVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRCNKIGVSTKDGVRRLLLVGD 452
            PVL D  GG +    T NG   CP  V+      +    L   P +N K  +V+VSTD+N+ F    +  PC      +W++D YD+      +  GG +G+PG ET+ +WFKIE+   F   G Y +V CP+VC SC  +C  +G+      RR L + D
Sbjct:   54 PVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFP-ENPKEDVVRVSTDLNINFS---AFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEE---FCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSD 207          
The following BLAST results are available for this feature:
BLAST of CF835318 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
ASP_THECC2.598e-1735.5321 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU4.899e-1635.40Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A16_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A16, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835318 ID=CF835318|Name=CF835318|organism=Citrus sinensis|type=EST|length=686bp
CTTATCCAGTCCTAGATGGCGCCGGTGGATTCAGCACACACCTTAGAACA
AATGGACAGTGTCCCTTGGACGTTATCCACCTAAGTTCTCCTAGCGAAAG
GGGAGATAATTTAAGATTACTTCCGTACGACAATTACAAAATTGTCAAGG
TATCCACTGATGTCAACCTGAGATTCCCCGTAAAAGTTTCTGTTAAGCCC
TGTAATGAAGAACCATTGTGGAAAGTTGATAGCTATGACGATCCATTAAT
TGTAACCGGCGGAAGTGAGGGCCACCCAGGAGCTGAAACGTTGCTAAATT
GGTTTAAGATTGAGAAAGCTGGAAATTTTTCATATGGTGGTGTATACAAT
ATTGTCCATTGTCCGAGTGTCTGTCTATCTTGTCCTAGACGCTGCAACAA
AATTGGCGTTTCAACTAAGGATGGCGTTCGACGTCTGCTTCTAGTTGGTG
ATCATGAACCGGCTTTGAATGTTCTGTTTTTTCCATCAGAGGAAAGCTCA
AGGCTACTTCAAGCTGCTAACGCAATATCAAGGTTTTTTGAAGCTGCTGA
AGCAATATCAATGACCGCGTAATGAATGAACTTAGCTGTATCATTCTAAA
TAATAGACCAGGCTAGTAACCTTTTATCTCTATTACAGAATAAAAATAAC
ACCGCCTGTGATCCTTTTGCTGTTAAAAAAAAAAAA
back to top