CF835319

Overview
NameCF835319
Unique NameCF835319
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length692
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10176 contig Csv1_Contig10176:168..859. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835319 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.078e-18
Identity = 58/156 (37.18%), Postives = 82/156 (52.56%), Query Frame = -3
Query:  229 LDGAGGFSTHLG--TNGQCPLDVIQLSSPSERGDNLRLLPYDNYK-IVKVSTDVNLRFPVKVSVKPCNEEPLWKVDSYDDPL----IVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRCNKIGVSTKDGVRRLLLVGDHE 675
            + GAGG    LG  T   CP  V+Q  S  + G  +     D+   +V+VSTDVN+ F V +  + C+   +W++D+YD+      + T G +G PG  TL +WFKIEKAG       Y    CPSVC SC   C+ IG  + D  +  L + D+E
Sbjct:   51 ISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEF-VPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVLG----YKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLALSDNE 201          
BLAST of CF835319 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 88.1965 bits (217), Expect = 4.508e-17
Identity = 58/163 (35.58%), Postives = 84/163 (51.53%), Query Frame = -3
Query:  235 LIPVLDGAGGFSTHLGT--NGQ--CPLDVIQLSSPSERGDNLRLLPYDNYK--IVKVSTDVNLRFPVKVSVKPCN--EEPLWKVDSYDDP----LIVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRCNKIGVSTKDGVRRLLLVGD 687
            ++PVL   GG  T   T  NG   CP  V+Q     +    L   P +N K  +V+VSTD+N+ F    +  PC      +W++D YD+      +  GG +G+PG ET+ +WFKIE+   F   G Y +V CP+VC SC  +C  +G+      RR L + D
Sbjct:   52 IVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFP-ENPKEDVVRVSTDLNINFS---AFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEE---FCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSD 207          
The following BLAST results are available for this feature:
BLAST of CF835319 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
ASP_THECC4.078e-1837.1821 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU4.508e-1735.58Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A16_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A16, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835319 ID=CF835319|Name=CF835319|organism=Citrus sinensis|type=EST|length=692bp
TTTTTTTTTTTCCACTGCAAAAGGATCACAGGCGGTGTTATTTTTATTCT
GTAATAGAGATAAAAGGTTACTAGCCTGGTCTATTATTTAGAATGATACA
GCTAAGTTCATTCATTACGCGGTCATTGATATTGCTTCAGCAGCTTCAAA
AAACCTTGATATTGCGTTAGCAGCTTGAAGTAGCCTTGAGCTTTCCTCTG
ATGGAAAAAACAGAACATTCAAAGCCGGTTCATGATCACCAACTAGAAGC
AGACGTCGAACGCCATCCTTAGTTGAAACGCCAATTTTGTTGCAGCGTCT
AGGACAAGATAGACAGACACTCGGACAATGGACAATATTGTATACACCAC
CATATGAAAAATTTCCAGCTTTCTCAATCTTAAACCAATTTAGCAACGTT
TCAGCTCCTGGGTGGCCCTCACTTCCGCCGGTTACAATTAATGGATCGTC
ATAGCTATCAACTTTCCACAATGGTTCTTCATTACAGGGCTTAACAGAAA
CTTTTACGGGGAATCTCAGGTTGACATCAGTGGATACCTTGACAATTTTG
TAATTGTCGTACGGAAGTAATCTTAAATTATCTCCCCTTTCGCTAGGAGA
ACTTAATTGGATAACGTCCAAGGGACACTGTCCATTTGTGCCTAGGTGTG
TGCTGAATCCACCGGCGCCATCTAGGACTGGGATAAGTTTAT
back to top