CF835325

Overview
NameCF835325
Unique NameCF835325
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11589 contig Csv1_Contig11589:14..697. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835325 vs. ExPASy Swiss-Prot
Match: HMT1_ARATH (Homocysteine S-methyltransferase 1 OS=Arabidopsis thaliana GN=HMT-1 PE=1 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 2.534e-73
Identity = 134/161 (83.23%), Postives = 149/161 (92.55%), Query Frame = 3
Query:  201 LDDLIEKAGGCAVIDGGFATQLETHGASINDPLWSALYLIKQPHLVKRVHLEYLEAGADILVTSSYQATIPGFLSRGLSIEEAESLLEKSVTLAVEARDKFWDAVKKVPGHNYNRALVAASIGSYGAYLADGSEYSGNYGPGVDLEKLKDFHRRRLQVLVE 683
            L+DLI+K GGCAV+DGGFATQLE HGA+INDPLWSA+ LIK P L+KRVH+EYLEAGADI+VTSSYQATIPGFLSRGLSIEE+ESLL+KSV LAVEARD+FW+ V KV GH+YNRALVAASIGSYGAYLADGSEYSG+YG  V L+KLKDFHRRRLQVLVE
Sbjct:   10 LEDLIKKCGGCAVVDGGFATQLEIHGAAINDPLWSAVSLIKNPELIKRVHMEYLEAGADIVVTSSYQATIPGFLSRGLSIEESESLLQKSVELAVEARDRFWEKVSKVSGHSYNRALVAASIGSYGAYLADGSEYSGHYGENVSLDKLKDFHRRRLQVLVE 170          
BLAST of CF835325 vs. ExPASy Swiss-Prot
Match: HMT1_MAIZE (Homocysteine S-methyltransferase 1 OS=Zea mays GN=HMT-1 PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 4.957e-61
Identity = 114/159 (71.70%), Postives = 133/159 (83.65%), Query Frame = 3
Query:  201 LDDLIEKAGGCAVIDGGFATQLETHGASINDPLWSALYLIKQPHLVKRVHLEYLEAGADILVTSSYQATIPGFLSRGLSIEEAESLLEKSVTLAVEARDKFWDAVKKVPGHNYNRALVAASIGSYGAYLADGSEYSGNYGPGVDLEKLKDFHRRRLQVL 677
            L+DL+ +AGGCAVIDGGFATQLE  GA INDPLWSA  LI +PHLVK VH++YLEAGAD++++SSYQATIPGF++RG+S+ EAE LL  SV LA EARD+FW +  +     YNRALVAASIGSYGAYLADGSEYSG+YG  +  EKLKDFHRRRLQVL
Sbjct:    4 LEDLVARAGGCAVIDGGFATQLEALGADINDPLWSAACLITRPHLVKEVHMQYLEAGADVIISSSYQATIPGFIARGMSVAEAEDLLRTSVKLANEARDEFWKSTLRKSKPIYNRALVAASIGSYGAYLADGSEYSGSYGADITAEKLKDFHRRRLQVL 162          
BLAST of CF835325 vs. ExPASy Swiss-Prot
Match: HMT3_ARATH (Homocysteine S-methyltransferase 3 OS=Arabidopsis thaliana GN=HMT3 PE=1 SV=2)

HSP 1 Score: 199.519 bits (506), Expect = 1.353e-50
Identity = 102/172 (59.30%), Postives = 129/172 (75.00%), Query Frame = 3
Query:  189 TASSLDDLIEKAGGCAVIDGGFATQLETHGASINDPLWSALYLIKQPHLVKRVHLEYLEAGADILVTSSYQATIPGFLSRGLSIEEAESLLEKSVTLAVEARDKFWDAVKK------VPGHNYNR-ALVAASIGSYGAYLADGSEYSGNYGPGVDLEKLKDFHRRRLQVLVE 683
            T+S + D +EK GG AV+DGGFAT+L+ HGA INDPLWSA  LI  PHLV +VHL+YLE+GA+I++T+SYQATI GF+++GLS+ EAE+LL +SV +  EAR+ F++   K        G    R  LVAAS+GSYGAYLADGSEYSG YG  V  E LKDFHRRR+Q+L +
Sbjct:    9 TSSLMTDFLEKCGGYAVVDGGFATELQRHGADINDPLWSAKCLITSPHLVTKVHLDYLESGANIIITASYQATIQGFVAKGLSVGEAENLLRRSVEITYEAREIFYNRCTKGSWDFAYAGKASRRPILVAASVGSYGAYLADGSEYSGIYGDSVSKETLKDFHRRRVQILAK 180          
BLAST of CF835325 vs. ExPASy Swiss-Prot
Match: HMT2_ARATH (Homocysteine S-methyltransferase 2 OS=Arabidopsis thaliana GN=HMT-2 PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 3.014e-50
Identity = 103/174 (59.20%), Postives = 127/174 (72.99%), Query Frame = 3
Query:  195 SSLDDLIEKAGGCAVIDGGFATQLETHGASINDPLWSALYLIKQPHLVKRVHLEYLEAGADILVTSSYQATIPGFLSRGLSIEEAESLLEKSVTLAVEARDKFWD-----------AVKKVPGHNYNRALVAASIGSYGAYLADGSEYSGNYGPGVDLEKLKDFHRRRLQVLVE 683
            +S+ D +++ GG AVIDGG AT+ E HGA +NDPLWSA  L+  PHL+  VHL+YLEAGADI+ ++SYQATI GF ++G S EE+ESLL+KSV +A EAR+ ++D            +KK P       LVAAS+GSYGAYLADGSEYSG YG  + LEKLKDFHRRRLQVL E
Sbjct:    7 NSMKDFLKQTGGYAVIDGGLATEFERHGADLNDPLWSAKCLVTSPHLIHTVHLDYLEAGADIISSASYQATIQGFEAKGFSREESESLLKKSVEIATEARNSYYDKCGTSSSMDDKILKKRP------ILVAASVGSYGAYLADGSEYSGIYGDSITLEKLKDFHRRRLQVLAE 174          
BLAST of CF835325 vs. ExPASy Swiss-Prot
Match: HMT2_MAIZE (Homocysteine S-methyltransferase 2 OS=Zea mays GN=HMT-2 PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 6.948e-47
Identity = 96/170 (56.47%), Postives = 125/170 (73.53%), Query Frame = 3
Query:  186 TTASSLDDLIEK----AGGCAVIDGGFATQLETHGASINDPLWSALYLIKQPHLVKRVHLEYLEAGADILVTSSYQATIPGFLSRGLSIEEAESLLEKSVTLAVEARDKFWDAVKKVPGHNYNRALVAASIGSYGAYLADGSEYSGNYGPGVDLEKLKDFHRRRLQVLVE 683
            T A S ++ + +    AGG  V+DGG AT+LE +GA +NDPLWSA  L+  PHL+++VH++YLEAGA+I++T+SYQATI GF S+G S E++E+LL KSV +A+EAR+ F     +      +  LVAAS+GSYGAYLADGSEYSG+YG     E LKDFHRRRLQVL E
Sbjct:    4 TAAGSAEEAVRRWVDAAGGRLVLDGGLATELEANGADLNDPLWSAKCLLSSPHLIRKVHMDYLEAGANIIITASYQATIQGFESKGFSKEQSENLLTKSVEIALEAREMFLKEHLEKSTPIQHPVLVAASLGSYGAYLADGSEYSGDYGEAGTKEFLKDFHRRRLQVLAE 173          
BLAST of CF835325 vs. ExPASy Swiss-Prot
Match: HMT4_MAIZE (Homocysteine S-methyltransferase 4 OS=Zea mays GN=HMT-4 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.185e-46
Identity = 93/162 (57.41%), Postives = 118/162 (72.84%), Query Frame = 3
Query:  192 ASSLDDLIEKAGGCAVIDGGFATQLETHGASINDPLWSALYLIKQPHLVKRVHLEYLEAGADILVTSSYQATIPGFLSRGLSIEEAESLLEKSVTLAVEARDKFWDAVKKVPGHNYNRALVAASIGSYGAYLADGSEYSGNYGPGVDLEKLKDFHRRRLQVL 677
            A +L   + +AGGCAV+DGG  T+LE HGA ++D LWSA  L   PHL+++VHL+YLEAGAD+++++SYQATI GF SRG S +E+E LL +SV +A EAR  F     +        ALVAAS+GSYGAY ADGSEYSG+YG  +  E LK+FHRRRLQVL
Sbjct:   11 AGALRGFVREAGGCAVVDGGLGTELEAHGADLHDALWSAKCLASAPHLIRKVHLDYLEAGADVIISASYQATIEGFQSRGFSRDESEELLRRSVHVAQEARRVFAAEGDRSSRRGRPPALVAASVGSYGAYRADGSEYSGDYGKSMTKEDLKNFHRRRLQVL 172          
BLAST of CF835325 vs. ExPASy Swiss-Prot
Match: HMT3_MAIZE (Homocysteine S-methyltransferase 3 OS=Zea mays GN=HMT-3 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.640e-46
Identity = 92/157 (58.60%), Postives = 120/157 (76.43%), Query Frame = 3
Query:  213 IEKAGGCAVIDGGFATQLETHGASINDPLWSALYLIKQPHLVKRVHLEYLEAGADILVTSSYQATIPGFLSRGLSIEEAESLLEKSVTLAVEARDKFWDAVKKVPGHNYNRALVAASIGSYGAYLADGSEYSGNYGPGVDLEKLKDFHRRRLQVLVE 683
            ++ AGG  V+DGG AT+LE +GA +NDPLWSA  L+  PHL+++VH++YLEAGA+I++T+SYQATI GF S+G S E++E+LL KSV +A+EAR+ F     +      +  LVAA++GSYGAYLADGSEYSG+YG     E LKDFHRRRLQVL E
Sbjct:   17 VDAAGGRLVLDGGLATELEANGADLNDPLWSAKCLLSSPHLIRKVHMDYLEAGANIIITASYQATIQGFESKGFSKEQSENLLTKSVQIALEAREMFLKEHLEKSTPIQHPILVAAALGSYGAYLADGSEYSGDYGEAGTKEFLKDFHRRRLQVLAE 173          
BLAST of CF835325 vs. ExPASy Swiss-Prot
Match: SMTA_ASTBI (Selenocysteine methyltransferase OS=Astragalus bisulcatus GN=SMTA PE=1 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 4.980e-45
Identity = 88/169 (52.07%), Postives = 120/169 (71.01%), Query Frame = 3
Query:  201 LDDLIEKAGGCAVIDGGFATQLETHGASINDPLWSALYLIKQPHLVKRVHLEYLEAGADILVTSSYQATIPGFLSRGLSIEEAESLLEKSVTLAVEARDKFWDAVKKVPGHNYNRA--------LVAASIGSYGAYLADGSEYSGNYGPGVDLEKLKDFHRRRLQVLVE 683
            + D + +AG  AVI GG  T+L+ HGA +NDPLWSA  L+  PHL+++VHL+YLE GADI++T+SYQATI GF ++G S EE E+LL +SV +A EARD ++    +    N + +        L+A S+GSYGAYLADGSE+SGNYG  +  E LKDFHRR++Q+L +
Sbjct:    6 ITDFLHQAGRAAVIAGGLGTELQRHGADLNDPLWSAKCLLSCPHLIRQVHLDYLENGADIIITASYQATIQGFKAKGFSDEEGEALLRRSVEIAREARDLYYQRCAESSSDNGDDSRILKQRPILIAGSVGSYGAYLADGSEFSGNYGDAIKSETLKDFHRRKVQILAD 174          
BLAST of CF835325 vs. ExPASy Swiss-Prot
Match: HMT_BACSU (Homocysteine S-methyltransferase ybgG OS=Bacillus subtilis GN=ybgG PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.452e-36
Identity = 76/149 (51.01%), Postives = 105/149 (70.47%), Query Frame = 3
Query:  237 VIDGGFATQLETHGASINDPLWSALYLIKQPHLVKRVHLEYLEAGADILVTSSYQATIPGFLSRGLSIEEAESLLEKSVTLAVEARDKFWDAVKKVPGHNYNRALVAASIGSYGAYLADGSEYSGNYGPGVDLEKLKDFHRRRLQVLVE 683
            V+DG  AT+LE  G ++ND LWSA  L+++P L+K+VH +Y  AGAD  +T+SYQ+T  GF +RGLS  EA  L+E SV++A EARD+FW   +     N  + ++AASIG YGAYLADGSEY GNY   +  ++L +FHR R++ L+E
Sbjct:   15 VLDGAMATELERKGCNLNDSLWSAKILMEEPELIKQVHTDYFAAGADCAITASYQSTFEGFAARGLSEAEARRLIELSVSIAAEARDEFWSLEEN--RLNRPKPIIAASIGPYGAYLADGSEYRGNY--AISEDELIEFHRPRMKALIE 159          
BLAST of CF835325 vs. ExPASy Swiss-Prot
Match: MMUM_ECOLI (Homocysteine S-methyltransferase OS=Escherichia coli (strain K12) GN=mmuM PE=1 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 3.243e-28
Identity = 66/149 (44.30%), Postives = 94/149 (63.09%), Query Frame = 3
Query:  237 VIDGGFATQLETHGASINDPLWSALYLIKQPHLVKRVHLEYLEAGADILVTSSYQATIPGFLSRGLSIEEAESLLEKSVTLAVEARDKFWDAVKKVPGHNYNRALVAASIGSYGAYLADGSEYSGNYGPGVDLEKLKDFHRRRLQVLVE 683
            ++DG  AT+LE  G ++ D LWSA  L++ P L++ VHL+Y  AGA   +T+SYQAT  GF +RGL   ++++L+ KSV LA +AR+ +               LVA S+G YGAYLADGSEY G+Y   V  E  + FHR R++ L++
Sbjct:   18 LLDGAMATELEARGCNLADSLWSAKVLVENPELIREVHLDYYRAGAQCAITASYQATPAGFAARGLDEAQSKALIGKSVELARKAREAY-----LAENPQAGTLLVAGSVGPYGAYLADGSEYRGDYHCSV--EAFQAFHRPRVEALLD 159          
The following BLAST results are available for this feature:
BLAST of CF835325 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
HMT1_ARATH2.534e-7383.23Homocysteine S-methyltransferase 1 OS=Arabidopsis ... [more]
HMT1_MAIZE4.957e-6171.70Homocysteine S-methyltransferase 1 OS=Zea mays GN=... [more]
HMT3_ARATH1.353e-5059.30Homocysteine S-methyltransferase 3 OS=Arabidopsis ... [more]
HMT2_ARATH3.014e-5059.20Homocysteine S-methyltransferase 2 OS=Arabidopsis ... [more]
HMT2_MAIZE6.948e-4756.47Homocysteine S-methyltransferase 2 OS=Zea mays GN=... [more]
HMT4_MAIZE1.185e-4657.41Homocysteine S-methyltransferase 4 OS=Zea mays GN=... [more]
HMT3_MAIZE2.640e-4658.60Homocysteine S-methyltransferase 3 OS=Zea mays GN=... [more]
SMTA_ASTBI4.980e-4552.07Selenocysteine methyltransferase OS=Astragalus bis... [more]
HMT_BACSU1.452e-3651.01Homocysteine S-methyltransferase ybgG OS=Bacillus ... [more]
MMUM_ECOLI3.243e-2844.30Homocysteine S-methyltransferase OS=Escherichia co... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A20_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A20, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835325 ID=CF835325|Name=CF835325|organism=Citrus sinensis|type=EST|length=684bp
CCTGAACTTTTTTTCTTTCCCTATTCAGAAATTATAATTTGAGCTGCATA
CACGTAACGAATATTCAAAAGAAAACAAAACCACCCTCTGTCTCCGGCGC
CCATAAAGCCTACACTTACCCTGTTTGTTCACTCCTGTTGGTGAGCGTAA
ATCTAAAGACTTTTCTGAATATGGGCAAGGAAAACACCACGGCGTCGTCT
TTGGATGATCTAATTGAGAAAGCCGGCGGCTGTGCTGTCATTGATGGAGG
CTTCGCTACCCAGCTTGAGACTCACGGCGCCTCCATTAACGACCCTCTTT
GGAGCGCTCTTTATTTGATCAAACAACCCCACCTCGTCAAGCGGGTTCAT
TTGGAATACCTGGAGGCCGGTGCTGATATTTTGGTCACTTCATCCTACCA
GGCCACCATTCCAGGCTTTCTTTCCAGGGGATTGTCAATCGAAGAAGCGG
AATCGTTACTAGAGAAGAGCGTTACATTGGCTGTTGAAGCCCGAGACAAG
TTCTGGGATGCTGTAAAGAAGGTTCCGGGGCATAACTACAACCGAGCATT
GGTTGCAGCTTCAATCGGAAGCTACGGAGCTTATCTTGCCGATGGTTCTG
AGTATAGTGGAAATTACGGACCTGGGGTAGATCTGGAGAAGCTGAAAGAT
TTCCACCGGCGCAGATTGCAAGTCCTTGTCGAAT
back to top