CF835328

Overview
NameCF835328
Unique NameCF835328
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length692
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835328 vs. ExPASy Swiss-Prot
Match: JOIN_SOLLC (MADS-box protein JOINTLESS OS=Solanum lycopersicum GN=J PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.122e-37
Identity = 88/166 (53.01%), Postives = 107/166 (64.46%), Query Frame = -2
Query:  254 SKNLERVDQPSVELQLLENNNYSMLFKEAAEKSHLLRQMRGEEIHGLSLEELQKLERFFEVGLGRVXXXXXXXXXXXINELQRRGKLLMEENERLRQQVAEVS-------------------------NAYGEEGQSSEFVNNICNSSNAPPPEFESSDPSLKLGL 676
            SKNLE++DQPS+ELQL+EN+NYS L KE +EKSH LRQMRGEE+ GL++EELQ+LER  E GL RV           IN+LQ++G  LMEENE+LRQQV E+S                         N   E+GQSSE V N CNS + PP + +SSD SLKLGL
Sbjct:   73 SKNLEKLDQPSLELQLVENSNYSRLSKEISEKSHRLRQMRGEELQGLNIEELQQLERSLETGLSRVIERKGDKIMREINQLQQKGMHLMEENEKLRQQVMEISNNNNNNNNGYREAGVVIFEPENGFNNNNNEDGQSSESVTNPCNSIDPPPQDDDSSDTSLKLGL 238          
BLAST of CF835328 vs. ExPASy Swiss-Prot
Match: SVP_ARATH (MADS-box protein SVP OS=Arabidopsis thaliana GN=SVP PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.306e-32
Identity = 82/169 (48.52%), Postives = 110/169 (65.09%), Query Frame = -2
Query:  242 SKNLERVDQPSVELQLLENNNYSMLFKEAAEKSHLLRQMRGEEIHGLSLEELQKLERFFEVGLGRVXXXXXXXXXXXINELQRRGKLLMEENERLRQQVAEVS--------------NAYG----------EEGQSSEFVNNICNSSNAPPPEFESSDPSLKLGLPYAG 676
            SKNLE++DQPS+ELQL+EN++++ + KE A+KSH LRQMRGEE+ GL +EELQ+LE+  E GL RV           I+ELQ++G  LM+EN+RLRQQ  +++              +A+G          EEGQSSE + N  NS+ A P + ESSD SL+LGLPY G
Sbjct:   73 SKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLDIEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQGTQLTEENERLGMQICNNVHAHGGAESENAAVYEEGQSSESITNAGNSTGA-PVDSESSDTSLRLGLPYGG 240          
BLAST of CF835328 vs. ExPASy Swiss-Prot
Match: MAD22_ORYSJ (MADS-box transcription factor 22 OS=Oryza sativa subsp. japonica GN=MADS22 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.354e-21
Identity = 68/152 (44.74%), Postives = 92/152 (60.53%), Query Frame = -2
Query:  251 SKNLERVDQPSVELQLLENNNYSMLFKEAAEKSHLLRQMRGEEIHGLSLEELQKLERFFEVGLGRVXXXXXXXXXXXINELQRRGKLLMEENERLRQQVAEVSNA---------YGEEGQSSEFVNNICNS-SNAPPPEFESSDPSLKLGLP 676
            S NL + +QPS++L L E++ Y+ L ++ AE S  LRQMRGEE+ GLS++ELQ+LE+  E GL RV           I+ELQR+   L EEN +LR QV+++S A         +  EGQSSE V    +S S+      + SD SLKLGLP
Sbjct:   73 SNNLGKAEQPSLDLNL-EHSKYAHLNEQLAEASLRLRQMRGEELEGLSIDELQQLEKNLEAGLHRVMLTKDQQFMEQISELQRKSSQLAEENMQLRNQVSQISPAEKQVVDTENFVTEGQSSESVMTALHSGSSQSQDNDDGSDVSLKLGLP 223          
BLAST of CF835328 vs. ExPASy Swiss-Prot
Match: MAD55_ORYSJ (MADS-box transcription factor 55 OS=Oryza sativa subsp. japonica GN=MADS55 PE=2 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 1.656e-19
Identity = 71/174 (40.80%), Postives = 92/174 (52.87%), Query Frame = -2
Query:  251 SKNLERVD-QPSVELQL---------------------LENNNYSMLFKEAAEKSHLLRQMRGEEIHGLSLEELQKLERFFEVGLGRVXXXXXXXXXXXINELQRRGKLLMEENERLRQQVAEV----------SNAYGEEGQSSEFVNNICNSSNAPPPEFESSDPSLKLGLP 676
            SKNL + D QPS++L                       LE++  S L ++ AE S  LRQMRGEE+ GLS+EELQ++E+  E GL RV           I+ELQR+G  L EEN RLR Q+ +V           N   E+GQSSE V    NS ++   + + SD SLKLGLP
Sbjct:   73 SKNLGKTDKQPSIDLNFFLIILLRTYTNSYAYIHLLLQLEHSKCSSLNEQLAEASLQLRQMRGEELEGLSVEELQQMEKNLEAGLQRVLCTKDQQFMQEISELQRKGIQLAEENMRLRDQMPQVPTAGLAVPDTENVLTEDGQSSESVMTALNSGSSQDND-DGSDISLKLGLP 245          
BLAST of CF835328 vs. ExPASy Swiss-Prot
Match: MAD47_ORYSJ (MADS-box transcription factor 47 OS=Oryza sativa subsp. japonica GN=MADS47 PE=1 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 1.186e-17
Identity = 64/155 (41.29%), Postives = 88/155 (56.77%), Query Frame = -2
Query:  254 SKNLERVDQPSVELQLLENNNYSMLFKEAAEKSHLLRQMRGEEIHGLSLEELQKLERFFEVGLGRVXXXXXXXXXXXINELQRRGKLLMEENERLRQQV-------------AEVSNAYGEEGQSSEFVNNICNSSNAPPPEFE-SSDPSLKLGL 676
            SK L+R +   ++LQ  +++  + L +E AE S  LRQMRGEE+H L++E+LQ+LE+  E GLG V           I+ L+R+   L+EEN RL++Q+                S    EEGQSSE V N   S   PPP+ + SSD SLKLGL
Sbjct:   92 SKTLQRAEPSQLDLQGEDSSTCARLKEELAETSLRLRQMRGEELHRLNVEQLQELEKSLESGLGSVLKTKSKKILDEIDGLERKRMQLIEENLRLKEQLQVSRMSRMEEMQPGPDSEIVYEEGQSSESVTNA--SYPRPPPDNDYSSDTSLKLGL 244          
The following BLAST results are available for this feature:
BLAST of CF835328 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
JOIN_SOLLC5.122e-3753.01MADS-box protein JOINTLESS OS=Solanum lycopersicum... [more]
SVP_ARATH1.306e-3248.52MADS-box protein SVP OS=Arabidopsis thaliana GN=SV... [more]
MAD22_ORYSJ1.354e-2144.74MADS-box transcription factor 22 OS=Oryza sativa s... [more]
MAD55_ORYSJ1.656e-1940.80MADS-box transcription factor 55 OS=Oryza sativa s... [more]
MAD47_ORYSJ1.186e-1741.29MADS-box transcription factor 47 OS=Oryza sativa s... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A22_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A22, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835328 ID=CF835328|Name=CF835328|organism=Citrus sinensis|type=EST|length=692bp
TTTTTTTTTTTTTTTTTCAGGCCCCCTGTAAAAATTATCATTACTAATAC
CATACTTGAACAAATGTAAATGTCACATTACATCGCATTAGTCTGAGGGG
CATATTTTTAATTAACCGGGAGTACAGAGTAAAGCCGAGGTTAAATTCAA
ATTCCATTACTACAATTAATACTTACCAAAATAAAAGACCATATAAATTC
ATCTTTAGTTGATGAAGCGAACACCTGGGGTCTACTTATTAGCCAGCATA
TGGTAAGCCCAGCTTGAGGGAGGGGTCTGAGCTTTCAAATTCAGGGGGAG
GAGCGTTTGATGAATTGCATATATTATTAACAAACTCTGAGGACTGGCCT
TCTTCACCGTATGCATTTGATACCTCCGCCACTTGCTGTCTTAATCGCTC
ATTCTCCTCCATCAATAACTTTCCCCTTCTTTGGAGTTCATTAATCTCCT
TTGAAATCTTTTCTTCCTTCTTTTCTATCACTCGTCCCAATCCAACTTCA
AAAAACCTTTCAAGCTTCTGCAATTCTTCTAAACTTAATCCATGGATCTC
CTCACCTCTCATTTGCCTCAGCAGATGGCTTTTTTCAGCAGCTTCCTTGA
ACAACATGGAGTAGTTGTTGTTCTCCAACAGCTGCAACTCAACAGATGGT
TGATCCACCCTCTCAAGGTTCTTTGAGGGCACACGGGGCTTT
back to top