CF835331

Overview
NameCF835331
Unique NameCF835331
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length685
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12029 contig Csv1_Contig12029:68..751. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835331 vs. ExPASy Swiss-Prot
Match: F10AL_ARATH (FAM10 family protein At4g22670 OS=Arabidopsis thaliana GN=At4g22670 PE=1 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 7.665e-54
Identity = 121/214 (56.54%), Postives = 133/214 (62.15%), Query Frame = 3
Query:   60 MDAEKLKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGK-SEPRA----SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIVEADNDPPQKMGDSSTEVTDXXXXXXXXXXXXXXXXISEGKLDEAIELSTEAIMLNP-SAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDL 683
            MD+ KL ELK FIDQCKS+PS+L  PSLSFFRDYLESL AK+PT  ++E K ++PR+                                     GD VE DNDPPQKMGDSS EVTD                +SEG  DEAIE  T AI LNP SAIMY  RASVYIK+KKPNAAIRDA AALEINPDSAKGYK+RGMA AMLG W EA  DL
Sbjct:    1 MDSTKLSELKVFIDQCKSDPSLLTTPSLSFFRDYLESLGAKIPTGVHEEDKDTKPRSFVVEESDDDMDETEEVKPKVEEEEEEDEIVESDVELEGDTVEPDNDPPQKMGDSSVEVTDENREAAQEAKGKAMEALSEGNFDEAIEHLTRAITLNPTSAIMYGNRASVYIKLKKPNAAIRDANAALEINPDSAKGYKSRGMARAMLGEWAEAAKDL 214          
BLAST of CF835331 vs. ExPASy Swiss-Prot
Match: F10A1_CHICK (Hsc70-interacting protein OS=Gallus gallus GN=ST13 PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 3.822e-37
Identity = 87/216 (40.28%), Postives = 117/216 (54.17%), Query Frame = 3
Query:   60 MDAEKLKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVP-------TDAYKEGKSEPRASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIVEADNDPPQKMGDSSTEVTDXXXXXXXXXXXXXXXXISEGKLDEAIELSTEAIMLNPS-AIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDL 683
            MD+ KL EL+ F+  CK NP +L    L F R+++ES+   +P       TD   +GK+E +                                    ++E DND PQ+MGD + EVT+                +SEG L +A+ L T+AI LNP  AI+YA RASV++K++KPNAAIRD   A++INPDSA+ YK RG AH +LGHWEEA HDL
Sbjct:    1 MDSRKLGELRAFVRLCKQNPGLLHTEELGFLREWVESMGGTIPPAPASTSTDETSKGKAEEQPEEPVKSPEPESEESDLEIDNEG-------------VIEPDNDDPQEMGDENVEVTEEMMDQANEKKMEAINALSEGDLQKAVNLFTDAIKLNPCLAILYAKRASVFVKLQKPNAAIRDCDRAIKINPDSAQTYKWRGKAHRLLGHWEEAAHDL 203          
BLAST of CF835331 vs. ExPASy Swiss-Prot
Match: F10A1_PONAB (Hsc70-interacting protein OS=Pongo abelii GN=ST13 PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 8.514e-37
Identity = 84/209 (40.19%), Postives = 117/209 (55.98%), Query Frame = 3
Query:   60 MDAEKLKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGKSEPRASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIVEADNDPPQKMGDSSTEVTDXXXXXXXXXXXXXXXXISEGKLDEAIELSTEAIMLNPS-AIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDL 683
            MD  K+ EL+ F+  CK +PS+L    + F R+++ES+  KVP  A ++ KSE                                      ++E D D PQ+MGD + E+T+                +++G+L +AI+L T+AI LNP  AI+YA RASV++K++KPNAAIRD   A+EINPDSA+ YK RG AH +LGHWEEA HDL
Sbjct:    1 MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPP-ATQKAKSEENTKEEKPDSKKVEEDLKADEPSSEESDLEIDKEG---VIEPDTDAPQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDL 205          
BLAST of CF835331 vs. ExPASy Swiss-Prot
Match: F10A1_HUMAN (Hsc70-interacting protein OS=Homo sapiens GN=ST13 PE=1 SV=2)

HSP 1 Score: 153.68 bits (387), Expect = 8.514e-37
Identity = 84/209 (40.19%), Postives = 117/209 (55.98%), Query Frame = 3
Query:   60 MDAEKLKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGKSEPRASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIVEADNDPPQKMGDSSTEVTDXXXXXXXXXXXXXXXXISEGKLDEAIELSTEAIMLNPS-AIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDL 683
            MD  K+ EL+ F+  CK +PS+L    + F R+++ES+  KVP  A ++ KSE                                      ++E D D PQ+MGD + E+T+                +++G+L +AI+L T+AI LNP  AI+YA RASV++K++KPNAAIRD   A+EINPDSA+ YK RG AH +LGHWEEA HDL
Sbjct:    1 MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPP-ATQKAKSEENTKEEKPDSKKVEEDLKADEPSSEESDLEIDKEG---VIEPDTDAPQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDL 205          
BLAST of CF835331 vs. ExPASy Swiss-Prot
Match: F10A1_MOUSE (Hsc70-interacting protein OS=Mus musculus GN=St13 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.452e-36
Identity = 83/209 (39.71%), Postives = 116/209 (55.50%), Query Frame = 3
Query:   60 MDAEKLKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGKSEPRASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIVEADNDPPQKMGDSSTEVTDXXXXXXXXXXXXXXXXISEGKLDEAIELSTEAIMLNPS-AIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDL 683
            MD  K+ EL+ F+  C+ +PS+L    + F R+++ES+  KVP   +K  KSE                                      ++E D D PQ+MGD + E+T+                +++G+L +AI+L T+AI LNP  AI+YA RASV++K++KPNAAIRD   A+EINPDSA+ YK RG AH +LGHWEEA HDL
Sbjct:    1 MDPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESMGGKVPPATHK-AKSEENTKEEKRDKTTEENIKTEELSSEESDLEIDNEG----VIEPDTDAPQEMGDENAEITEEMMDEANEKKGAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDL 204          
BLAST of CF835331 vs. ExPASy Swiss-Prot
Match: F10A1_RAT (Hsc70-interacting protein OS=Rattus norvegicus GN=St13 PE=1 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 3.235e-36
Identity = 83/209 (39.71%), Postives = 116/209 (55.50%), Query Frame = 3
Query:   60 MDAEKLKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGKSEPRASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIVEADNDPPQKMGDSSTEVTDXXXXXXXXXXXXXXXXISEGKLDEAIELSTEAIMLNPS-AIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDL 683
            MD  K+ EL+ F+  C+ +PS+L    + F R+++ES+  KVP   +K  KSE                                      ++EAD D PQ+MGD + E+T+                +++G+L +AI+L T+AI LNP  AI+YA RASV++K++KPNAAIRD   A+EINPDSA+ YK RG AH +LGHWEEA  DL
Sbjct:    1 MDPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESMGGKVPPATHK-AKSEENTKEEKRDKTTEDNIKTEEPSSEESDLEIDNEG----VIEADTDAPQEMGDENAEITEAMMDEANEKKGAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAARDL 204          
BLAST of CF835331 vs. ExPASy Swiss-Prot
Match: F10A5_HUMAN (Protein FAM10A5 OS=Homo sapiens GN=FAM10A5 PE=1 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 7.207e-36
Identity = 83/209 (39.71%), Postives = 117/209 (55.98%), Query Frame = 3
Query:   60 MDAEKLKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGKSEPRASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIVEADNDPPQKMGDSSTEVTDXXXXXXXXXXXXXXXXISEGKLDEAIELSTEAIMLNPS-AIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDL 683
            MD  K+ EL+ F+  CK +PS+L    + F R+++ES+  KVP  A ++ KSE                                      ++E D D PQ+MGD + E+T+                +++G+L +AI+L T+AI LNP  AI+YA RASV++K++KPNAAI+D   A+EINPDSA+ YK RG AH +LGHWEEA HDL
Sbjct:    1 MDPCKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPP-ATQKAKSEENTKEEKPDSKKVEEDLKADEPSTEESDLEIDKEG---VIEPDTDAPQEMGDENVEITEEMMDQANDKKVAAIEVLNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIQDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDL 205          
BLAST of CF835331 vs. ExPASy Swiss-Prot
Match: F10A4_HUMAN (Protein FAM10A4 OS=Homo sapiens GN=FAM10A4 PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 7.968e-35
Identity = 82/209 (39.23%), Postives = 114/209 (54.55%), Query Frame = 3
Query:   60 MDAEKLKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGKSEPRASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIVEADNDPPQKMGDSSTEVTDXXXXXXXXXXXXXXXXISEGKLDEAIELSTEAIMLNPS-AIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDL 683
            MD  K+ EL+ F+  CK +PSIL    + F R+++ES+       A ++ KSE                                      ++E D D PQ+MGD + E+T+                +++G+L +AI+L T+AI LNP  AI+YA RASV++K++KPNAAIRD   A+EINPDSA+ YK RG AH +LGHWEEA HDL
Sbjct:    1 MDPRKVNELRAFVKMCKKDPSILHTQEMRFLREWVESMGGT----ATQKAKSEENTKEEKPDSKVEEDLKADEPSSEESDLEIDKEG----VIEPDTDAPQEMGDENAEITEEVMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKRRGKAHRLLGHWEEAAHDL 201          
BLAST of CF835331 vs. ExPASy Swiss-Prot
Match: HRP_PLABE (58 kDa phosphoprotein OS=Plasmodium berghei PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.320e-21
Identity = 70/230 (30.43%), Postives = 102/230 (44.35%), Query Frame = 3
Query:   60 MDAEKLKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTD--AYKEGKSEPRASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIVEADNDPPQKMGDSSTEVTDXXXXXXXXXXXXXXXXISEGKLDEAIELSTEAIML--------------------NPSAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDL 683
            MD EK+++LK+F+  C+ NPSIL  P LSFF+D++ES   K+  D   Y++ KSE                                        E ++D P+K+     E+                  +SE +++E  +L  EA+ L                    NPSA++Y  RAS+ + +K+P A IRD T AL +N DSA  YK R  A+  LG WE A  D+
Sbjct:    1 MDIEKIEDLKKFVASCEENPSILLKPELSFFKDFIESFGGKIKKDKMGYEKMKSEDSTEEKSDEEEEDEEEEEE---------------------EEEDDDPEKL-----ELIKEEAVECPPLAPIIEGELSEEQIEEICKLKEEAVDLVENKKYEEALEKYNKIISFGNPSAMIYTKRASILLNLKRPKACIRDCTEALNLNVDSANAYKIRAKAYRYLGKWEFAHADM 204          
The following BLAST results are available for this feature:
BLAST of CF835331 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
F10AL_ARATH7.665e-5456.54FAM10 family protein At4g22670 OS=Arabidopsis thal... [more]
F10A1_CHICK3.822e-3740.28Hsc70-interacting protein OS=Gallus gallus GN=ST13... [more]
F10A1_PONAB8.514e-3740.19Hsc70-interacting protein OS=Pongo abelii GN=ST13 ... [more]
F10A1_HUMAN8.514e-3740.19Hsc70-interacting protein OS=Homo sapiens GN=ST13 ... [more]
F10A1_MOUSE1.452e-3639.71Hsc70-interacting protein OS=Mus musculus GN=St13 ... [more]
F10A1_RAT3.235e-3639.71Hsc70-interacting protein OS=Rattus norvegicus GN=... [more]
F10A5_HUMAN7.207e-3639.71Protein FAM10A5 OS=Homo sapiens GN=FAM10A5 PE=1 SV... [more]
F10A4_HUMAN7.968e-3539.23Protein FAM10A4 OS=Homo sapiens GN=FAM10A4 PE=1 SV... [more]
HRP_PLABE1.320e-2130.4358 kDa phosphoprotein OS=Plasmodium berghei PE=1 S... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A23_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A23, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835331 ID=CF835331|Name=CF835331|organism=Citrus sinensis|type=EST|length=685bp
CGCCTATTACTCCTTTAAAGGCGAGAAGNTAAAGAACCCTTGAACGAAGG
GCCTCTGCAATGGACGCAGAAAAATTGAAAGAACTGAAACAGTTCATCGA
TCAGTGCAAATCGAATCCTTCCATTCTCGCCGACCCCTCCCTCTCCTTCT
TCCGCGACTATCTCGAAAGTCTCCATGCCAAAGTGCCTACCGATGCGTAC
AAAGAAGGCAAATCCGAACCGAGGGCCTCTGTGGTGGAGGAGAGCGAAGA
GGAAGAACAAAGAGTAGAAGTAGAAGAAAAAGAGGAAGAAGAGGATGAAA
TAGTCGAGTCCGATATTGAGCTTGAAGGAGATATTGTGGAGGCTGATAAT
GATCCTCCTCAGAAGATGGGAGACAGTTCGACAGAAGTTACTGATGAGAA
ACGCGAAGCGGCTGCGGAGGCAAAGGCCAAGGCCATGGAAGCCATCTCTG
AAGGAAAGTTGGACGAGGCAATTGAGCTTTCGACTGAGGCTATTATGCTG
AATCCATCAGCCATTATGTATGCAACTAGAGCCAGTGTATACATCAAAAT
GAAGAAGCCTAATGCTGCCATCCGGGATGCCACTGCAGCTTTAGAGATTA
ACCCAGATTCTGCTAAGGGCTACAAGACCCGTGGCATGGCACATGCAATG
CTAGGTCACTGGGAGGAGGCTGTGCATGATCTTCA
back to top