CF835335

Overview
NameCF835335
Unique NameCF835335
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length822
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9744 contig Csv1_Contig9744:120..941. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835335 vs. ExPASy Swiss-Prot
Match: HCBT2_DIACA (Anthranilate N-benzoyltransferase protein 2 OS=Dianthus caryophyllus GN=HCBT2 PE=1 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.924e-47
Identity = 110/285 (38.60%), Postives = 168/285 (58.95%), Query Frame = 2
Query:    5 IHVMESTIIRPAQETPKHRLQISDLDMIV--PSNYVPSVYFYRRSSDCTD--------FFEVGLLKKALSEVLVPFYPVAGRLQKDENRKIEILCNGEGVLFLEAETSCGIDDFGDFSQGSKL-LTLVPTVGDTKDISSHPLLMAQVTYFKCGGVCVGTRVNHTLVDGASAYHIINSWAETTRGVPISTQPFYDRTI-LSVGVPTSPKFHHIEYDP-PPSMNAPPTQNPEIISTAILNLSLDQIHTLKEKSKTDHEPNVKYSRMAILAAHIWRSMC*ARGLSDDQ 820
            I + +ST++RPA+ETP   L +S +DMI+  P ++  +V  Y++  +  D        +F+  +L +ALS+ LVP+YP+AGRL+ + +R  EI CN EG LF+EAE+S  ++DFGDF    +L   +VPT   +K ISS PLLM Q+T F+CGGV +G   +H   DG S +   NSWA   +G+  + +P +DR + L +  P   K+ H +++P  PS+           S  +  LS +QI+TLK+K         + S   ++A H+WRS+  ARGLSD +
Sbjct:    3 IQIKQSTMVRPAEETPNKSLWLSKIDMILRTPYSHTGAVLIYKQPDNNEDNIHPSSSMYFDANILIEALSKALVPYYPMAGRLKINGDR-YEIDCNAEGALFVEAESSHVLEDFGDFRPNDELHRVMVPTCDYSKGISSFPLLMVQLTRFRCGGVSIGFAQHHHACDGMSHFEFNNSWARIAKGLLPALEPVHDRYLHLRLRNPPQIKYTHSQFEPFVPSLPNELLDGKTNKSQTLFKLSREQINTLKQKLDLSSNTTTRLSTYEVVAGHVWRSVSKARGLSDHE 286          
BLAST of CF835335 vs. ExPASy Swiss-Prot
Match: HCBT3_DIACA (Anthranilate N-benzoyltransferase protein 3 OS=Dianthus caryophyllus GN=HCBT3 PE=1 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 5.599e-47
Identity = 111/285 (38.95%), Postives = 170/285 (59.65%), Query Frame = 2
Query:    5 IHVMESTIIRPAQETPKHRLQISDLDMIV--PSNYVPSVYFYRRSSDCTD--------FFEVGLLKKALSEVLVPFYPVAGRLQKDENRKIEILCNGEGVLFLEAETSCGIDDFGDFSQGSKL-LTLVPTVGDTKDISSHPLLMAQVTYFKCGGVCVGTRVNHTLVDGASAYHIINSWAETTRGVPISTQPFYDRTI-LSVGVPTSPKFHHIEYDP-PPSMNAPPTQNPEIISTAILNLSLDQIHTLKEKSKTDHEPNVKYSRMAILAAHIWRSMC*ARGLSDDQ 820
            IH+ +ST++RPA+ETP   L +S +DMI+  P ++  +V  Y++  +  D        +F+  +L +ALS+ LVP+YP+AGRL+ + +R  EI CNGEG LF+EAE+S  ++DFGDF    +L   +VPT   +K ISS PLLM Q+T F+CGGV +G   +H + D  S +   NSWA   +G+  + +P +DR + L    P   K+ H +++P  PS+           S  +  LS +QI+TLK+K    +    + S   ++A H+WRS+  ARGLSD +
Sbjct:    3 IHIKQSTMVRPAEETPNKSLWLSKIDMILRTPYSHTGAVLIYKQPDNNEDNIQPSSSMYFDANILIEALSKALVPYYPMAGRLKINGDR-YEIDCNGEGALFVEAESSHVLEDFGDFRPNDELHRVMVPTCDYSKGISSFPLLMVQLTRFRCGGVSIGFAQHHHVCDRMSHFEFNNSWARIAKGLLPALEPVHDRYLHLCPRNPPQIKYTHSQFEPFVPSLPKELLDGKTSKSQTLFKLSREQINTLKQKLDWSN-TTTRLSTYEVVAGHVWRSVSKARGLSDHE 285          
BLAST of CF835335 vs. ExPASy Swiss-Prot
Match: HCBT1_DIACA (Anthranilate N-benzoyltransferase protein 1 OS=Dianthus caryophyllus GN=HCBT1 PE=1 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 9.550e-47
Identity = 111/285 (38.95%), Postives = 171/285 (60.00%), Query Frame = 2
Query:    5 IHVMESTIIRPAQETPKHRLQISDLDMIV--PSNYVPSVYFYRRSSDCTD--------FFEVGLLKKALSEVLVPFYPVAGRLQKDENRKIEILCNGEGVLFLEAETSCGIDDFGDFSQGSKL-LTLVPTVGDTKDISSHPLLMAQVTYFKCGGVCVGTRVNHTLVDGASAYHIINSWAETTRGVPISTQPFYDRTI-LSVGVPTSPKFHHIEYDP-PPSMNAPPTQNPEIISTAILNLSLDQIHTLKEKSKTDHEPNVKYSRMAILAAHIWRSMC*ARGLSDDQ 820
            I + +ST++RPA+ETP   L +S++DMI+  P ++  +V  Y++  +  D        +F+  +L +ALS+ LVPFYP+AGRL+ + +R  EI CN EG LF+EAE+S  ++DFGDF    +L   +VPT   +K ISS PLLM Q+T F+CGGV +G   +H + DG + +   NSWA   +G+  + +P +DR + L    P   K+ H +++P  PS+           S  +  LS +QI+TLK+K    +    + S   ++AAH+WRS+  ARGLSD +
Sbjct:    3 IQIKQSTMVRPAEETPNKSLWLSNIDMILRTPYSHTGAVLIYKQPDNNEDNIHPSSSMYFDANILIEALSKALVPFYPMAGRLKINGDR-YEIDCNAEGALFVEAESSHVLEDFGDFRPNDELHRVMVPTCDYSKGISSFPLLMVQLTRFRCGGVSIGFAQHHHVCDGMAHFEFNNSWARIAKGLLPALEPVHDRYLHLRPRNPPQIKYSHSQFEPFVPSLPNELLDGKTNKSQTLFILSREQINTLKQKLDLSNN-TTRLSTYEVVAAHVWRSVSKARGLSDHE 285          
BLAST of CF835335 vs. ExPASy Swiss-Prot
Match: T5AT_TAXCH (Taxadien-5-alpha-ol O-acetyltransferase OS=Taxus chinensis PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.289e-24
Identity = 75/234 (32.05%), Postives = 120/234 (51.28%), Query Frame = 2
Query:    5 IHVMESTIIRPAQETPKHRLQISDLDMI--VPSNYVPSVYFYRRSSDCT--DFFEVGLLKKALSEVLVPFYPVAGRLQKDENRKIEILCNGEGVLFLEAETSCGIDDFGDFSQGS----KLLTLVPTVGDTKDISSHPLLMAQVTYFKCGGVCVGTRVNHTLVDGASAYHIINSWAETTRG-VPISTQPFYDRTILSVGVPTSPKFHHIEYDPPPSMNAPPTQNPEIISTAILN 679
            +++ E  ++ P+   PK  LQ+S +D +  V  +   ++  Y  S   T        L+++AL+++LV + P AGRL++ EN  +E+ C GEG +FLEA     +   GDF   +    +LL  +P   + KD+   PLL+ QVT F CGG  VG   +H + DG  A   +   AE  RG V +S +P ++R ++ +  P   +F H E+   PS+     Q   II    +N
Sbjct:    8 VNLNEKVMVGPSLPLPKTTLQLSSIDNLPGVRGSIFNALLIYNASPSPTMVSADPAKLIREALAKILVYYPPFAGRLRETENGDLEVECTGEGAMFLEAMADNELSVLGDFDDSNPSFQQLLFSLPLDTNFKDL---PLLVVQVTRFTCGGFVVGVSFHHGVCDGRGAAQFLKGLAEMARGEVKLSLEPIWNRELVKLDDPKYLQFFHFEFLRAPSIVEKIVQTYFIIDFETIN 238          
BLAST of CF835335 vs. ExPASy Swiss-Prot
Match: DBAT_TAXCU (10-deacetylbaccatin III 10-O-acetyltransferase OS=Taxus cuspidata PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.989e-24
Identity = 83/250 (33.20%), Postives = 128/250 (51.20%), Query Frame = 2
Query:    5 IHVMESTIIRPAQETPKHRLQISDLDMI--VPSNYVPSVYFYRRSSDCTDFFEVGLLKKALSEVLVPFYPVAGRLQKDENRKIEILCNGEGVLFLEAETSCGIDDFGDFSQGS----KLLTLVPTVGDTKDISSHPLLMAQVTYFKCGGVCVGTRVNHTLVDGASAYHIINSWAETTRG-VPISTQPFYDRTILSVGVPTSP----KFHHIEYDPPPSMNAPPTQNPEIISTAILNLSLDQIHTLKEKSK 721
            +  +E  ++ P+Q +PK  LQ+S LD +  V  N   ++  Y  +SD        ++++ALS+VLV + P AGRL+K EN  +E+ C GEG LF+EA     +   GD    S    +LL  +P   D +DI  HPL++ QVT F CGG  VG    H + DG  A   + +  E  RG +  S++P + R +L    P  P    +++H +   PPS      Q   +I++  +N        L+E+SK
Sbjct:    9 VRSLERVMVAPSQPSPKAFLQLSTLDNLPGVRENIFNTLLVYN-ASDRVSVDPAKVIRQALSKVLVYYSPFAGRLRKKENGDLEVECTGEGALFVEAMADTDLSVLGDLDDYSPSLEQLLFCLPPDTDIEDI--HPLVV-QVTRFTCGGFVVGVSFCHGICDGLGAGQFLIAMGEMARGEIKPSSEPIWKRELLK---PEDPLYRFQYYHFQLICPPSTFGKIVQGSLVITSETINCIK---QCLREESK 248          
BLAST of CF835335 vs. ExPASy Swiss-Prot
Match: T5AT_TAXCU (Taxadien-5-alpha-ol O-acetyltransferase OS=Taxus cuspidata GN=TAT PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.136e-23
Identity = 74/234 (31.62%), Postives = 120/234 (51.28%), Query Frame = 2
Query:    5 IHVMESTIIRPAQETPKHRLQISDLDMI--VPSNYVPSVYFYRRSSDCTDFFE--VGLLKKALSEVLVPFYPVAGRLQKDENRKIEILCNGEGVLFLEAETSCGIDDFGDFSQGS----KLLTLVPTVGDTKDISSHPLLMAQVTYFKCGGVCVGTRVNHTLVDGASAYHIINSWAETTRG-VPISTQPFYDRTILSVGVPTSPKFHHIEYDPPPSMNAPPTQNPEIISTAILN 679
            ++++E  ++ P+   PK  LQ+S +D +  V  +   ++  Y  S   T         +++AL+++LV + P AGRL++ EN  +E+ C GEG +FLEA     +   GDF   +    +LL  +P   + KD+S   LL+ QVT F CGG  VG   +H + DG  A   +   AE  RG V +S +P ++R ++ +  P   +F H E+   PS+     Q   II    +N
Sbjct:    8 VNLIEKVMVGPSPPLPKTTLQLSSIDNLPGVRGSIFNALLIYNASPSPTMISADPAKPIREALAKILVYYPPFAGRLRETENGDLEVECTGEGAMFLEAMADNELSVLGDFDDSNPSFQQLLFSLPLDTNFKDLS---LLVVQVTRFTCGGFVVGVSFHHGVCDGRGAAQFLKGLAEMARGEVKLSLEPIWNRELVKLDDPKYLQFFHFEFLRAPSIVEKIVQTYFIIDFETIN 238          
BLAST of CF835335 vs. ExPASy Swiss-Prot
Match: BAHD1_ARATH (BAHD acyltransferase At5g47980 OS=Arabidopsis thaliana GN=BAHD1 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.619e-20
Identity = 74/269 (27.51%), Postives = 126/269 (46.84%), Query Frame = 2
Query:    5 IHVMESTIIRPAQETPKHRLQISDLDMIVPSNYVPSVYFYRRSSDCTDFFEV--GLLKKALSEVLVPFYPVAGRLQKDENRKIEILCNGEGVLFLEAETSCGIDDFGDFSQGSKLLTLVPTVGDTKDISSHPLLMAQVTYFKCG-GVCVGTRVNHTLVDGASAYHIINSWAETTRGVPISTQPFYDRTILSVGVPTSPKFHHIEYDPPPSMN---APPTQNPEIISTAILN---LSLDQIHTLKEKSKTDHEPNVKYSRMAILAAHIWR 784
            + V++  +I+P+   P  RLQ+S +D  +    VP ++FY  +       ++    L+ +LS+ L  FYP+AG+ +      + I CN EG +F EA T+  + +F      + L  L+PT+   + + S PLL  Q T+F  G G+ VG  V+H + D AS    +  WA T RG              S    ++P+F  +   PP  ++   +P     E+    + N      D+I  LK  + +   P+   +R+  + + IWR
Sbjct:    5 LEVIQREVIKPSSPAPHDRLQLSVIDFGIAEACVPMIFFYNLADLAEKSPDIVSTRLRSSLSQALSRFYPLAGKKEG-----VSISCNDEGAVFTEARTNLLLSEFLRNIDINSLKILIPTLAPGESLDSRPLLSVQATFFGSGSGLAVGICVSHCICDAASVSTFVRGWAATARGD-------------SNDELSTPQFAEVAIHPPADISIHGSPFNALSEVREKCVTNRFVFESDKITKLKIVAASKSVPSP--TRVEAVMSLIWR 253          
BLAST of CF835335 vs. ExPASy Swiss-Prot
Match: DBNBT_TAXCA (3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase OS=Taxus canadensis GN=TAX10 PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.420e-20
Identity = 75/259 (28.96%), Postives = 132/259 (50.97%), Query Frame = 2
Query:   17 ESTIIRPAQETPKHRLQISDLDMIVPSNYVPSVYFYRRSSDCTDFFEVGLLKKALSEVLVPFYPVAGRLQKDENRKIEILCNGEGVLFLEA---ETSCGIDDFGDFSQGSKLLTLVPTVGDTKDISSHPLLMAQVTYFKCGGVCVGTRVNHTLVDGASAYHIINSWAETTRG-VPISTQPFYDRTILSVGVPTSPKFHHIEYDPPPSMNAPPTQNPEIISTAILNLSLDQIHTLKEKSKTDHEPNVKYSRMAILAAHIW 781
            +  ++ P+  +PK  +Q+S +D +     + +      + D      V ++++ALS+VLV ++P+AGRL+  E  ++E+ C G+G LF+EA   +T   + D  D +   + L     + DT     H L++ QVT F CGG+ VG  + H++ DG  A   + + AE  RG V  S +P ++R +L+   P  P   H++ +   S+  PP    E +  A   +++D I  +K+      E N   S   ++AA +W
Sbjct:   15 DPVMVAPSLPSPKATVQLSVVDSLTICRGIFNTLLVFNAPDNISADPVKIIREALSKVLVYYFPLAGRLRSKEIGELEVECTGDGALFVEAMVEDTISVLRDLDDLNPSFQQLVFWHPL-DTAIEDLH-LVIVQVTRFTCGGIAVGVTLPHSVCDGRGAAQFVTALAEMARGEVKPSLEPIWNRELLN---PEDPL--HLQLNQFDSICPPPML--EELGQASFVINVDTIEYMKQ--CVMEECNEFCSSFEVVAALVW 262          
BLAST of CF835335 vs. ExPASy Swiss-Prot
Match: DCR_ARATH (BAHD acyltransferase DCR OS=Arabidopsis thaliana GN=DCR PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.467e-20
Identity = 91/299 (30.43%), Postives = 136/299 (45.48%), Query Frame = 2
Query:    2 KIHVMESTIIRPAQET-PKHRLQISDLDMIVPSNYVPSVYFYRRSSDCTDFFE-------VGLLKKALSEVLVPFYPVAGRLQKDENRKIEILCNGE-----GVLFLEAETS-CGIDDFGDFSQGSKLLTLVPTVGDTK-DISSHPLLMAQVTYFKCGGVCVGTRVNHTLVDGASAYHIINSWAETTRGV-PISTQPFYDR-----TILSVGVPTSPKFHHIEYDPPPSMN----APPTQNPEIISTAILNLSLDQIHTLKEKSKT--DHEPNVKYSRMAILAAHIWRSMC*ARGLSDD 817
            KI +M  T ++P +    K +  ++  D+   + Y    +   +  +  D  E       V  LK  L  VL  FY +AG+L KD+     +  + E     GV F  A  +   +DD       +K   LVP  G    +  S PLL  QVT  K  G+ +G   NH ++DG S +H ++SWAE  RG   ISTQPF DR     T + + + T+PK      DP  + N    A PT  P  +   I   S   +HT+K ++ +    + +  +S    L +HIWR +  ARGL  +
Sbjct:    2 KIKIMSKTHVKPTKPVLGKKQFHLTTFDLPYLAFYYNQKFLLYKFQNLLDLEEPTFQNEVVENLKDGLGLVLEDFYQLAGKLAKDDEGVFRVEYDAEDSEINGVEFSVAHAADVTVDDLTAEDGTAKFKELVPYNGILNLEGLSRPLLAVQVTKLK-DGLAMGLAFNHAVLDGTSTWHFMSSWAEICRGAQSISTQPFLDRSKARDTRVKLDL-TAPK------DPNETSNGEDAANPTVEPPQLVEKIFRFSDFAVHTIKSRANSVIPSDSSKPFSTFQSLTSHIWRHVTLARGLKPE 292          
BLAST of CF835335 vs. ExPASy Swiss-Prot
Match: DBBT_TAXCU (2-alpha-hydroxytaxane 2-O-benzoyltransferase OS=Taxus cuspidata PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.895e-19
Identity = 77/263 (29.28%), Postives = 126/263 (47.91%), Query Frame = 2
Query:    5 IHVMESTIIRPAQETPKHRLQISDLDMIVPS-NYVPSVY-FYRRSSDCTDFFEVGLLKKALSEVLVPFYPVAGRLQKDENRKIEILCNGEGVLFLEAETSCGIDDFGDFSQ-GSKLLTLVPTVGDTKDISSHPLLMAQVTYFKCGGVCVGTRVNHTLVDGASAYHIINSWAETTRG-VPISTQPFYDRTILSVGVPTSPKFHHIEYDPPPSMNAPPTQNPEIISTAILNLSLDQIHTLKEKSKTDHEPNVKYSRMAILAAHIW 781
            + ++E  I+ P  ++PK+ L +S +D        + SVY   +R S   D      +++ALS+VLV + P AGRL+  EN  +E+ C GEG +F+EA     +    DF++       LV  + +  +I    LL  QVT F CGG  VGTR +H++ DG     ++    E  RG    S +P ++R ++        +F H ++  PP        N E    A + +S ++I+ +K       E    +S   ++ A IW
Sbjct:    6 VDMIERVIVAPCLQSPKNILHLSPIDNKTRGLTNILSVYNASQRVSVSAD--PAKTIREALSKVLVYYPPFAGRLRNTENGDLEVECTGEGAVFVEAMADNDLSVLQDFNEYDPSFQQLVFNLREDVNIEDLHLLTVQVTRFTCGGFVVGTRFHHSVSDGKGIGQLLKGMGEMARGEFKPSLEPIWNREMVKPEDIMYLQFDHFDFIHPP-------LNLEKSIQASMVISFERINYIKRCMM--EECKEFFSAFEVVVALIW 257          
The following BLAST results are available for this feature:
BLAST of CF835335 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
HCBT2_DIACA1.924e-4738.60Anthranilate N-benzoyltransferase protein 2 OS=Dia... [more]
HCBT3_DIACA5.599e-4738.95Anthranilate N-benzoyltransferase protein 3 OS=Dia... [more]
HCBT1_DIACA9.550e-4738.95Anthranilate N-benzoyltransferase protein 1 OS=Dia... [more]
T5AT_TAXCH2.289e-2432.05Taxadien-5-alpha-ol O-acetyltransferase OS=Taxus c... [more]
DBAT_TAXCU2.989e-2433.2010-deacetylbaccatin III 10-O-acetyltransferase OS=... [more]
T5AT_TAXCU1.136e-2331.62Taxadien-5-alpha-ol O-acetyltransferase OS=Taxus c... [more]
BAHD1_ARATH2.619e-2027.51BAHD acyltransferase At5g47980 OS=Arabidopsis thal... [more]
DBNBT_TAXCA3.420e-2028.963'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase ... [more]
DCR_ARATH4.467e-2030.43BAHD acyltransferase DCR OS=Arabidopsis thaliana G... [more]
DBBT_TAXCU2.895e-1929.282-alpha-hydroxytaxane 2-O-benzoyltransferase OS=Ta... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01B03_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01B03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835335 ID=CF835335|Name=CF835335|organism=Citrus sinensis|type=EST|length=822bp
GAAAATTCACGTCATGGAGTCAACAATTATACGCCCTGCTCAAGAAACAC
CCAAGCATCGCCTACAAATATCCGACCTAGACATGATTGTGCCATCCAAT
TACGTTCCCAGTGTGTATTTCTATCGGCGGTCCAGTGACTGCACCGATTT
TTTTGAAGTTGGTTTGCTGAAGAAGGCTCTGAGCGAAGTTCTTGTGCCGT
TTTACCCCGTTGCCGGAAGGTTGCAGAAGGATGAAAATCGCAAAATTGAG
ATTCTATGTAACGGAGAGGGAGTTTTGTTTCTGGAGGCCGAAACAAGTTG
TGGTATTGATGATTTCGGTGACTTCTCACAAGGCTCGAAACTCCTGACGC
TTGTTCCAACTGTTGGTGATACAAAGGATATATCCTCCCATCCACTCTTG
ATGGCACAGGTAACTTATTTCAAATGTGGAGGCGTTTGTGTTGGAACTAG
AGTGAATCATACACTGGTAGATGGAGCTTCAGCGTACCATATCATCAACT
CATGGGCGGAGACGACGCGTGGCGTTCCTATTAGCACTCAACCATTCTAT
GATCGGACCATACTGAGTGTTGGGGTTCCAACTTCTCCCAAATTCCATCA
CATTGAATATGACCCGCCTCCTTCCATGAACGCTCCTCCTACCCAAAATC
CTGAAATCATTTCTACCGCAATCCTTAACCTATCACTTGATCAAATCCAC
ACCCTCAAAGAGAAATCTAAGACAGATCATGAACCCAACGTCAAGTATAG
TAGGATGGCGATCCTAGCAGCACATATCTGGCGTAGCATGTGTTAAGCGC
GCGGATTATCTGATGATCAAGT
back to top