CF835362

Overview
NameCF835362
Unique NameCF835362
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length732
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1707 contig Csv1_Contig1707:13..744. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835362 vs. ExPASy Swiss-Prot
Match: Y1736_ARATH (REF/SRPP-like protein At1g67360 OS=Arabidopsis thaliana GN=At1g67360 PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 5.052e-62
Identity = 120/214 (56.07%), Postives = 150/214 (70.09%), Query Frame = 3
Query:   99 METERKKQE---LRHLGFMRIAAIQALVCVSSLYDYAKRNSGPLRSPVGTVESAVTAVVGPVYQKFKGVPXXXXXXXXXXXXEASRKFDEHAPPLAKRVASQVHSLIETASQKAQNLVSEAQTGGPRAAVHYAAAESKHLLVTNSVKAWYKLNHYALFHTMADMAVPTAAQWSKKYNHLVVEMTKKGYTVFGYLPLVPIDDIAKAFKQSEAPKK 731
            METE+K  +   L+HL F+RIA I  L  VS+LY+YAK+NSGPL+S V  VE AVT VV PVYQKFK VP            E S KFDEHAPP+AK+V +Q H LI  A++KAQ+ V EA+TGGP+AA +YAA E K  +VTNSVK W KLN Y   H M D A+P AA +S +YN LV +MT  GY++ GYLPLVP+DDI KA+++ +A +K
Sbjct:    1 METEKKNSKEVALKHLAFVRIATIHILASVSNLYEYAKQNSGPLKSAVEKVEGAVTTVVTPVYQKFKDVPDSLLVFLDHKVGEVSYKFDEHAPPMAKKVVNQAHVLIYKATEKAQSFVKEARTGGPKAAFNYAATEYKFFVVTNSVKVWAKLNQYKPIHAMGDKALPVAAHFSSRYNDLVTDMTNMGYSLVGYLPLVPVDDIVKAYEKEDARRK 214          
BLAST of CF835362 vs. ExPASy Swiss-Prot
Match: SRP_VITRI (Stress-related protein OS=Vitis riparia GN=SRP PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.772e-33
Identity = 84/218 (38.53%), Postives = 117/218 (53.67%), Query Frame = 3
Query:  114 KKQELRHLGFMRIAAIQALVCVSSLYDYAKRNSGPLRSPVGTVESAVTAVVGPVYQKFKGVPXXXXXXXXXXXXEASRKFDEHAPPLAKRVASQVHSLIETASQKAQNLVSEAQTGGPRAAVH------YAAAE-------SKHLLVTN--SVKAWYKLNHYALFHTMADMAVPTAAQWSKKYNHLVVEMTKKGYTVFGYLPLVPIDDIAKAFKQSEA 722
            +++ L++L F+++AAI  +VC SSLY+YAK NSGPL+  V TVE  V  V+GPVY+KF  VP             +  + + H P L KR + Q  ++ + A + A  + SE Q  G            Y+  E       SK+  V    +V AW  LN   LF  +A + VPTAA WS+KYN  V    ++GYTV  YLPL+P + IAK F+   A
Sbjct:   16 EEKRLKYLDFVQVAAIYVIVCFSSLYEYAKENSGPLKPGVQTVEGTVKTVIGPVYEKFYDVPFELLMFVDRKVEASIYELERHVPSLVKRASCQAITVAQKAPELALAVASEVQRPGVVDTAKNITKNVYSKCEPTAKELCSKYEPVAEQYAVSAWRSLNRLPLFPQVAQVVVPTAAYWSEKYNQSVSYTAERGYTVALYLPLIPTERIAKVFQDGSA 233          
BLAST of CF835362 vs. ExPASy Swiss-Prot
Match: Y3550_ARATH (REF/SRPP-like protein At3g05500 OS=Arabidopsis thaliana GN=At3g05500 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.752e-30
Identity = 83/223 (37.22%), Postives = 119/223 (53.36%), Query Frame = 3
Query:  105 TERKKQELRHLGFMRIAAIQALVCVSSLYDYAKRNSGPLRSPVGTVESAVTAVVGPVYQKFKGVPXXXXXXXXXXXXEASRKFDEHAPPLAKRVASQVHSLIETASQKAQNLVSEAQTGG-----------------PRAAVHYAAAESKHLLVTNSVKAWYKLNHYALFHTMADMAVPTAAQWSKKYNHLVVEMTKKGYTVFGYLPLVPIDDIAKAFKQSEA 722
            T+ +K+ L++L F++ AA++AL+  + +Y  AK  SGPL+  V +VE AV  VVGPVY+K+  VP             +  + D   PP+ K+V++Q  S  + A   A+ L SE +  G                 P A   YA  E K      +V AW KLN   LF  +A +AVPTAA  S+KYN  VV+  +KGY V  Y+PLVP + I+K F + +A
Sbjct:   15 TKEEKERLKYLQFVQAAAVEALLRFALIYAKAKDKSGPLKPGVESVEGAVKTVVGPVYEKYHDVPVEVLKYMDQKVDMSVTELDRRVPPVVKQVSAQAISAAQIAPIVARALASEVRRAGVVETASGMAKSVYSKYEPAAKELYANYEPK--AEQCAVSAWKKLNQLPLFPRLAQVAVPTAAFCSEKYNDTVVKAAEKGYRVTSYMPLVPTERISKIFAEEKA 235          
BLAST of CF835362 vs. ExPASy Swiss-Prot
Match: Y5513_ORYSJ (REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 OS=Oryza sativa subsp. japonica GN=Os05g0151300 PE=2 SV=2)

HSP 1 Score: 117.472 bits (293), Expect = 7.619e-26
Identity = 74/216 (34.26%), Postives = 114/216 (52.78%), Query Frame = 3
Query:   87 RSEDMETERKKQELRHLGFMRIAAIQALVCVSSLYDYAKRNSGPLRSPVGTVESAVTAVVGPVYQKFKGVPXXXXXXXXXXXXEASRKFDEHAPP-------LAKRVASQVH--SLIETASQKAQNLVSEAQTGGPRAAVHYAAAESKHLLVTNSVKAWYKLNHYALFHTMADMAVPTAAQWSKKYNHLVVEMTKKGYTVFGYLPLVPIDDIAKAF 707
            ++ +ME   +++ LR+L F++ AA Q LV  ++ Y YAK+ +GPLR  V  VE  V AVVGPVY +F GVP            E+ ++ D   PP       LA+  A++V    L+ TA+  A++ ++ A+   PRA   Y   E   +    + +AW  LN   L  ++    +P AA  S +YN  V +  K+G  V  YLPLVP + +++ F
Sbjct:   22 KTPEMEAAAEEERLRYLEFVQQAAAQVLVLAAAAYAYAKQGAGPLRPGVDHVEGTVKAVVGPVYDRFHGVPLDLLKFLDRKVGESVQELDRRVPPVVKEAPGLARSAAAEVRQAGLVGTATGLAKSAIARAE---PRARDLYTRYEP--VAERKAAEAWAALNRLPLVPSVTRAVLPAAASLSARYNTAVADGAKRGSAVATYLPLVPTERLSRVF 232          
BLAST of CF835362 vs. ExPASy Swiss-Prot
Match: Y5513_ORYSI (REF/SRPP-like protein OsI_017815 OS=Oryza sativa subsp. indica GN=OsI_017815 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 7.619e-26
Identity = 74/216 (34.26%), Postives = 114/216 (52.78%), Query Frame = 3
Query:   87 RSEDMETERKKQELRHLGFMRIAAIQALVCVSSLYDYAKRNSGPLRSPVGTVESAVTAVVGPVYQKFKGVPXXXXXXXXXXXXEASRKFDEHAPP-------LAKRVASQVH--SLIETASQKAQNLVSEAQTGGPRAAVHYAAAESKHLLVTNSVKAWYKLNHYALFHTMADMAVPTAAQWSKKYNHLVVEMTKKGYTVFGYLPLVPIDDIAKAF 707
            ++ +ME   +++ LR+L F++ AA Q LV  ++ Y YAK+ +GPLR  V  VE  V AVVGPVY +F GVP            E+ ++ D   PP       LA+  A++V    L+ TA+  A++ ++ A+   PRA   Y   E   +    + +AW  LN   L  ++    +P AA  S +YN  V +  K+G  V  YLPLVP + +++ F
Sbjct:   22 KTPEMEAAAEEERLRYLEFVQQAAAQVLVLAAAAYAYAKQGAGPLRPGVDHVEGTVKAVVGPVYDRFHGVPLDLLKFLDRKVGESVQELDRRVPPVVKEAPGLARSAAAEVRQAGLVGTATGLAKSAIARAE---PRARDLYTRYEP--VAERKAAEAWAALNRLPLVPSVTRAVLPAAASLSARYNTAVADGAKRGSAVATYLPLVPTERLSRVF 232          
BLAST of CF835362 vs. ExPASy Swiss-Prot
Match: SRP_PHAVU (Stress-related protein OS=Phaseolus vulgaris GN=SRP PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.294e-22
Identity = 65/174 (37.36%), Postives = 87/174 (50.00%), Query Frame = 3
Query:  186 LYDYAKRNSGPLRSPVGTVESAVTAVVGPVYQKFKGVPXXXXXXXXXXXXEASRKFDEHAPPLAKRVASQVHSLIETASQKAQNLVSEAQTGGPRAAVHYAAAESKHLLVTNSVKAWYKLNHYALFHTMADMAVPTAAQWSKKYNHLVVEMTKKGYTVFGYLPLVPIDDIAKAF 707
            LY YAK  +GPL+  V TVE AV  VV PVY +F  VP            E     D H P   K+V+SQ           A+++VSE +  G         ++ +      +V AW KLN   LF  +A+  +P AA  ++KYN ++V   +KGY V  YLPLVP + IAK F
Sbjct:    6 LYSYAKERAGPLKPGVNTVEDAVKTVVAPVYDRFHLVPVELLKYADRKVGE----LDRHVPSNVKKVSSQ-----------ARSVVSEVRRDGVSTFAKTVYSKYEPTAEQCAVSAWRKLNQLPLFPQVANAVLPKAAYCTEKYNEVIVSSAEKGYRVSAYLPLVPTEKIAKVF 164          
BLAST of CF835362 vs. ExPASy Swiss-Prot
Match: SRPP_HEVBR (Small rubber particle protein OS=Hevea brasiliensis GN=SRPP PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.294e-22
Identity = 66/203 (32.51%), Postives = 103/203 (50.74%), Query Frame = 3
Query:   99 METERKKQELRHLGFMRIAAIQALVCVSSLYDYAKRNSGPLRSPVGTVESAVTAVVGPVYQKFKGVPXXXXXXXXXXXXEASRKFDEHAPPLAKRVASQVHSLIETASQKAQNLVSEAQTGGPRAAVHYAAAESKHLLVTNSVKAWYKLNHYALFHTMADMAVPTAAQWSKKYNHLVVEMTKKGYTVFGYLPLVPIDDIAKAF 707
            M  E +++ L++L F+R A + A+   S+LY YAK  SGPL+  V T+E+ V  VV PVY     +P             +    D   PP+ K+V++Q +S+ + A +   ++ S     G +       A  +      +V  W  LN   L   +A++ VPTA  +S+KYN +V   T++GY V  YLPL+P + I K F
Sbjct:    1 MAEEVEEERLKYLDFVRAAGVYAVDSFSTLYLYAKDISGPLKPGVDTIENVVKTVVTPVYY----IPLEAVKFVDKTVDVSVTSLDGVVPPVIKQVSAQTYSVAQDAPRIVLDVASSVFNTGVQEGAKALYANLEPKAEQYAVITWRALNKLPLVPQVANVVVPTAVYFSEKYNDVVRGTTEQGYRVSSYLPLLPTEKITKVF 199          
BLAST of CF835362 vs. ExPASy Swiss-Prot
Match: Y2778_ARATH (REF/SRPP-like protein At2g47780 OS=Arabidopsis thaliana GN=At2g47780 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.638e-21
Identity = 59/206 (28.64%), Postives = 99/206 (48.06%), Query Frame = 3
Query:  117 KQELRHLGFMRIAAIQALVCVSSLYDYAKRNSGPLRSPVGTVESAVTAVVGPVYQKFKGVPXXXXXXXXXXXXEASRKFDEHAPPLAKRVASQVHSLIETASQ-----KAQNLVSEAQTGGPRAAVHYAAAESKHLLVTNSVKAWYKLNHYALFHTMADMAVPTAAQWSKKYNHLVVEMTKKGYTVFGYLPLVPIDDIAKAFKQSE 719
            + +L+HL F+++AA+    C S+LY+ AK N+GPL+  V  +E  V  V+ P+Y+KF  VP            +     + + P L K+ +SQ  ++     +       +++    +     AA +YAA              W  LN   LF  +A + +PTA  WS+KYN  V  +  + Y    YLP++PI+ I+   +Q +
Sbjct:   38 EMKLKHLEFIQVAAVYFAACFSTLYELAKDNAGPLKLGVENIEDCVRTVLAPLYEKFHDVPFKLLLFVDRKVDDVFFDVETYVPSLVKQASSQALTVATEVQRTGVVDTTKSIARSVRDKYEPAAEYYAAT------------LWRLLNQLPLFPEVAHLVIPTAFYWSEKYNDAVRYVGDRDYFGAEYLPMIPIEKISDILEQDQ 231          
The following BLAST results are available for this feature:
BLAST of CF835362 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
Y1736_ARATH5.052e-6256.07REF/SRPP-like protein At1g67360 OS=Arabidopsis tha... [more]
SRP_VITRI3.772e-3338.53Stress-related protein OS=Vitis riparia GN=SRP PE=... [more]
Y3550_ARATH1.752e-3037.22REF/SRPP-like protein At3g05500 OS=Arabidopsis tha... [more]
Y5513_ORYSJ7.619e-2634.26REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 ... [more]
Y5513_ORYSI7.619e-2634.26REF/SRPP-like protein OsI_017815 OS=Oryza sativa s... [more]
SRP_PHAVU2.294e-2237.36Stress-related protein OS=Phaseolus vulgaris GN=SR... [more]
SRPP_HEVBR2.294e-2232.51Small rubber particle protein OS=Hevea brasiliensi... [more]
Y2778_ARATH9.638e-2128.64REF/SRPP-like protein At2g47780 OS=Arabidopsis tha... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01B21_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01B21, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835362 ID=CF835362|Name=CF835362|organism=Citrus sinensis|type=EST|length=732bp
CGGTTTACACATTATTGAACGCTGCAATCAATAGCAAACTAATTTCTCGC
GAGATCTAAAAGCAATATCGAATAATTCATCTTTTGCGCAGTGAAGATAT
GGAGACTGAGAGGAAGAAACAGGAACTGAGGCATCTTGGATTTATGAGGA
TAGCCGCGATTCAGGCTCTGGTGTGCGTGTCGAGTTTGTACGACTACGCA
AAACGCAACTCGGGGCCGCTACGCTCACCGGTTGGGACTGTCGAAAGCGC
CGTGACTGCCGTCGTGGGACCTGTTTATCAGAAATTCAAGGGCGTGCCTG
ATGATCTCCTCGTTTTTCTTGATAAGAAGGTGGATGAGGCTTCACGCAAG
TTTGACGAGCACGCTCCCCCTTTGGCCAAGCGGGTTGCCAGCCAAGTACA
TAGTCTAATTGAAACAGCATCACAGAAAGCTCAAAATCTTGTGAGTGAGG
CCCAAACCGGGGGGCCTCGAGCAGCTGTCCATTATGCTGCTGCTGAGTCT
AAACACCTTCTGGTAACAAATTCCGTGAAAGCATGGTATAAACTAAACCA
CTATGCATTGTTCCACACAATGGCAGATATGGCTGTTCCCACAGCTGCAC
AGTGGTCCAAGAAGTATAACCATCTTGTCGTGGAGATGACGAAGAAGGGT
TACACAGTCTTTGGCTATCTTCCTTTGGTTCCCATTGATGACATAGCCAA
AGCTTTTAAGCAGAGTGAAGCTCCCAAGAAAG
back to top