CF835363

Overview
NameCF835363
Unique NameCF835363
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length753
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1496 contig Csv1_Contig1496:43..795. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835363 vs. ExPASy Swiss-Prot
Match: RD19A_ARATH (Cysteine proteinase RD19a OS=Arabidopsis thaliana GN=RD19A PE=2 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 3.420e-93
Identity = 165/226 (73.01%), Postives = 185/226 (81.86%), Query Frame = 3
Query:   72 DDVDQMIRQVTDGGDEILSHHESTNNDLLGAEHHFSLFKKKFNKAYASQEEHDHRFTIFKANLRRAARHQKLDPSATHGITQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACK 749
            D  D +IRQV  G +            +L +E HFSLFK+KF K YAS EEHD+RF++FKANLRRA RHQKLDPSATHG+TQFSDLT +EFR+ +LG+R   +LPKDA++APILPT +LP DFDWR+ GAV PVK+QGSCGSCWSFS TGALEGANFLATGKLVSLSEQQLVDCDHECDPEE  SCDSGCNGGLMNSAFEYTLK GGLM+EEDYPYTG D G  CK
Sbjct:   27 DGDDLVIRQVVGGAEP----------QVLTSEDHFSLFKRKFGKVYASNEEHDYRFSVFKANLRRARRHQKLDPSATHGVTQFSDLTRSEFRKKHLGVRSGFKLPKDANKAPILPTENLPEDFDWRDHGAVTPVKNQGSCGSCWSFSATGALEGANFLATGKLVSLSEQQLVDCDHECDPEEADSCDSGCNGGLMNSAFEYTLKTGGLMKEEDYPYTGKD-GKTCK 241          
BLAST of CF835363 vs. ExPASy Swiss-Prot
Match: A494_ARATH (Probable cysteine proteinase A494 OS=Arabidopsis thaliana GN=At2g21430 PE=2 SV=2)

HSP 1 Score: 337.421 bits (864), Expect = 4.939e-92
Identity = 163/225 (72.44%), Postives = 186/225 (82.67%), Query Frame = 3
Query:   75 DVDQMIRQVTDGGDEILSHHESTNNDLLGAEHHFSLFKKKFNKAYASQEEHDHRFTIFKANLRRAARHQKLDPSATHGITQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACK 749
            D D +IRQV D           T   +L +E HF+LFKKKF K Y S EEH +RF++FKANL RA RHQK+DPSA HG+TQFSDLT +EFRR +LG++   +LPKDA+QAPILPT +LP +FDWR++GAV PVK+QGSCGSCWSFSTTGALEGA+FLATGKLVSLSEQQLVDCDHECDPEE GSCDSGCNGGLMNSAFEYTLK GGLMRE+DYPYTGTD G +CK
Sbjct:   25 DEDVLIRQVVD----------ETEPKVLSSEDHFTLFKKKFGKVYGSIEEHYYRFSVFKANLLRAMRHQKMDPSARHGVTQFSDLTRSEFRRKHLGVKGGFKLPKDANQAPILPTQNLPEEFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLATGKLVSLSEQQLVDCDHECDPEEEGSCDSGCNGGLMNSAFEYTLKTGGLMREKDYPYTGTD-GGSCK 238          
BLAST of CF835363 vs. ExPASy Swiss-Prot
Match: CYSP_PEA (Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.539e-85
Identity = 150/224 (66.96%), Postives = 183/224 (81.70%), Query Frame = 3
Query:   81 DQMIRQVTDGGDEILSHHESTNNDLLGAEHHFSLFKKKFNKAYASQEEHDHRFTIFKANLRRAARHQKLDPSATHGITQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKF 752
            D +IRQV D  ++           LL AEHHF+ FK KF+K+YA++EEHD+RF +FK+NL +A  HQ  DP+A HGIT+FSDLT +EFRR +LGL+++LRLP  A +APILPT +LP DFDWREKGAV PVKDQGSCGSCW+FSTTGALEGA++LATGKLVSLSEQQLVDCDH CDPE+ GSCDSGCNGGLMN+AFEY L++GG+++E+DY YTG D   +CKF
Sbjct:   27 DFIIRQVVDNEED----------HLLNAEHHFTSFKSKFSKSYATKEEHDYRFGVFKSNLIKAKLHQNRDPTAEHGITKFSDLTASEFRRQFLGLKKRLRLPAHAQKAPILPTTNLPEDFDWREKGAVTPVKDQGSCGSCWAFSTTGALEGAHYLATGKLVSLSEQQLVDCDHVCDPEQAGSCDSGCNGGLMNNAFEYLLESGGVVQEKDYAYTGRD--GSCKF 238          
BLAST of CF835363 vs. ExPASy Swiss-Prot
Match: CYSP1_MAIZE (Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 2.542e-80
Identity = 149/234 (63.68%), Postives = 174/234 (74.36%), Query Frame = 3
Query:   69 IDDVDQMIRQVTDGGDEILSHHESTNNDL-LGAEHHFSLFKKKFNKAYASQEEHDHRFTIFKANLRRAARHQKLDPSATHGITQFSDLTPAEFRRTYLGLRRKLR-----LPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKF 752
            +D  D +IRQV  GGD+         NDL L AE HF  F ++F K+Y   +EH +R ++FK NLRRA RHQ LDPSA HG+T+FSDLTPAEFRRTYLGLR+  R     L + A +AP+LPT+ LP DFDWR+ GAVGPVK+QGSCGSCWSFS +GALEGA++LATGKL  LSEQQ VDCDHECD  EP SCDSGCNGGLM +AF Y  KAGGL  E+DYPYTG+D    CKF
Sbjct:   21 VDAEDPLIRQVVPGGDD---------NDLELNAESHFLSFVQRFGKSYKDADEHAYRLSVFKDNLRRARRHQLLDPSAEHGVTKFSDLTPAEFRRTYLGLRKSRRALLRELGESAHEAPVLPTDGLPDDFDWRDHGAVGPVKNQGSCGSCWSFSASGALEGAHYLATGKLEVLSEQQFVDCDHECDSSEPDSCDSGCNGGLMTTAFSYLQKAGGLESEKDYPYTGSD--GKCKF 243          
BLAST of CF835363 vs. ExPASy Swiss-Prot
Match: CYSP1_DICDI (Cysteine proteinase 1 OS=Dictyostelium discoideum GN=cprA PE=1 SV=2)

HSP 1 Score: 174.096 bits (440), Expect = 7.231e-43
Identity = 98/209 (46.89%), Postives = 125/209 (59.81%), Query Frame = 3
Query:  156 LGAEHHFSLFKKKFNKAYASQEEHDHRFTIFKANLRRA------ARHQKLDPSATHGITQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPT---NDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHEC-DPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKF 752
            L  +  F  F+ KFNK Y S EE+  RF IFK+NL +       A + K D     G+ +F+DL+  EF+  YL  +  +    D   A  L     N +P  FDWR +GAV PVK+QG CGSCWSFSTTG +EG +F++  KLVSLSEQ LVDCDHEC + E   +CD GCNGGL  +A+ Y +K GG+  E  YPYT  + G  C F
Sbjct:   23 LEEQSQFLEFQDKFNKKY-SHEEYLERFEIFKSNLGKIEELNLIAINHKADTK--FGVNKFADLSSDEFKNYYLNNKEAI-FTDDLPVADYLDDEFINSIPTAFDWRTRGAVTPVKNQGQCGSCWSFSTTGNVEGQHFISQNKLVSLSEQNLVDCDHECMEYEGEQACDEGCNGGLQPNAYNYIIKNGGIQTESSYPYT-AETGTQCNF 226          
BLAST of CF835363 vs. ExPASy Swiss-Prot
Match: GCP1_ARATH (Germination-specific cysteine protease 1 OS=Arabidopsis thaliana GN=GCP1 PE=2 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 3.968e-41
Identity = 87/176 (49.43%), Postives = 118/176 (67.05%), Query Frame = 3
Query:  222 EHDHRFTIFKANLRRAARHQKLDPSATH--GITQFSDLTPAEFRRTYLGLR----RKLRLPKDADQAPILPTN--DLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTG 725
            + D RF IFK NLR    H + + +AT+  G+T+F+DLT  E+R+ YLG R    R++   K+ +Q      N  ++P   DWR+KGAV P+KDQG+CGSCW+FSTT A+EG N + TG+L+SLSEQ+LVDCD         S + GCNGGLM+ AF++ +K GGL  E+DYPY G
Sbjct:   69 DQDKRFNIFKDNLRFIDLHNEDNKNATYKLGLTKFTDLTNDEYRKLYLGARTEPARRIAKAKNVNQKYSAAVNGKEVPETVDWRQKGAVNPIKDQGTCGSCWAFSTTAAVEGINKIVTGELISLSEQELVDCDK--------SYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPYRG 236          
BLAST of CF835363 vs. ExPASy Swiss-Prot
Match: XCP1_ARATH (Xylem cysteine proteinase 1 OS=Arabidopsis thaliana GN=XCP1 PE=1 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 9.774e-40
Identity = 86/184 (46.74%), Postives = 110/184 (59.78%), Query Frame = 3
Query:  174 FSLFKKKFNKAYASQEEHDHRFTIFKANLRRAARHQKLDPSATHGITQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPIL--PTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPY 719
            F  +  + +KAY S EE  HRF +F+ NL    +      S   G+ +F+DLT  EF+  YLGL +     K    A        DLP   DWR+KGAV PVKDQG CGSCW+FST  A+EG N + TG L SLSEQ+L+DCD         + +SGCNGGLM+ AF+Y +  GGL +E+DYPY
Sbjct:   51 FESWMSEHSKAYKSVEEKVHRFEVFRENLMHIDQRNNEINSYWLGLNEFADLTHEEFKGRYLGLAKPQFSRKRQPSANFRYRDITDLPKSVDWRKKGAVAPVKDQGQCGSCWAFSTVAAVEGINQITTGNLSSLSEQELIDCD--------TTFNSGCNGGLMDYAFQYIISTGGLHKEDDYPY 226          
BLAST of CF835363 vs. ExPASy Swiss-Prot
Match: ORYA_ORYSJ (Oryzain alpha chain OS=Oryza sativa subsp. japonica GN=Os04g0650000 PE=1 SV=2)

HSP 1 Score: 163.696 bits (413), Expect = 9.774e-40
Identity = 87/209 (41.63%), Postives = 121/209 (57.89%), Query Frame = 3
Query:  120 ILSHHESTNNDLLGAEHHFSLFKKKFNKAYASQEEHDHRFTIFKANLRRAARHQKLDPSATH----GITQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTND-LPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTD 731
            I+S+ E +  +   A   ++ +K +  K+Y +  E + R+  F+ NLR    H     +  H    G+ +F+DLT  E+R TYLGLR K R  +      +   N+ LP   DWR KGAV  +KDQG CGSCW+FS   A+EG N + TG L+SLSEQ+LVDCD         S + GCNGGLM+ AF++ +  GG+  E+DYPY G D
Sbjct:   25 IVSYGERSEEE---ARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRFADLTNEEYRDTYLGLRNKPRRERKVSDRYLAADNEALPESVDWRTKGAVAEIKDQGGCGSCWAFSAIAAVEGINQIVTGDLISLSEQELVDCD--------TSYNEGCNGGLMDYAFDFIINNGGIDTEDDYPYKGKD 222          
BLAST of CF835363 vs. ExPASy Swiss-Prot
Match: CYSP2_DICDI (Cysteine proteinase 2 OS=Dictyostelium discoideum GN=cprB PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.667e-39
Identity = 92/197 (46.70%), Postives = 118/197 (59.90%), Query Frame = 3
Query:  174 FSLFKKKFNKAYASQEEHDHRFTIFKANLRRAAR-HQKLDPSATHGITQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDL---PADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKF 752
            F+ +  KFN+ Y+S E   +R++IFK+N+      + K D     G+  F+D+T  E+R+TYLG R         D   +L   DL   P   DWR K AV P+KDQG CGSCWSFSTTG+ EGA+ L T KLVSLSEQ LVDC     PEE    + GC+GGLMN+AF+Y +K  G+  E  YPYT  + G  C F
Sbjct:   36 FTEWTLKFNRQYSSSE-FSNRYSIFKSNMDYVDNWNSKGDSQTVLGLNNFADITNEEYRKTYLGTRVNAHSYNGYDGREVLNVEDLQTNPKSIDWRTKNAVTPIKDQGQCGSCWSFSTTGSTEGAHALKTKKLVSLSEQNLVDCS---GPEE----NFGCDGGLMNNAFDYIIKNKGIDTESSYPYT-AETGSTCLF 223          
BLAST of CF835363 vs. ExPASy Swiss-Prot
Match: ALEU_ARATH (Thiol protease aleurain OS=Arabidopsis thaliana GN=ALEU PE=1 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 1.667e-39
Identity = 102/229 (44.54%), Postives = 123/229 (53.71%), Query Frame = 3
Query:   75 DVDQMIRQVTDGGDEILSHHESTNNDLLGAEHH---FSLFKKKFNKAYASQEEHDHRFTIFKANLRRAARHQKLDPSATHGITQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKF 752
            D    IR V+DG  E+    E + + +LG   H   F+ F  ++ K Y + EE   RF+IFK NL       K   S   G+ QF+DLT  EF+RT LG  +             +    LP   DWRE G V PVKDQG CGSCW+FSTTGALE A   A GK +SLSEQQLVDC    +       + GCNGGL + AFEY    GGL  E+ YPYTG D    CKF
Sbjct:   27 DESNPIRMVSDGLREV----EESVSQILGQSRHVLSFARFTHRYGKKYQNVEEMKLRFSIFKENLDLIRSTNKKGLSYKLGVNQFADLTWQEFQRTKLGAAQNCSATLKGSHK--VTEAALPETKDWREDGIVSPVKDQGGCGSCWTFSTTGALEAAYHQAFGKGISLSEQQLVDCAGAFN-------NYGCNGGLPSQAFEYIKSNGGLDTEKAYPYTGKD--ETCKF 240          
The following BLAST results are available for this feature:
BLAST of CF835363 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 155
Match NameE-valueIdentityDescription
RD19A_ARATH3.420e-9373.01Cysteine proteinase RD19a OS=Arabidopsis thaliana ... [more]
A494_ARATH4.939e-9272.44Probable cysteine proteinase A494 OS=Arabidopsis t... [more]
CYSP_PEA1.539e-8566.96Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1[more]
CYSP1_MAIZE2.542e-8063.68Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=... [more]
CYSP1_DICDI7.231e-4346.89Cysteine proteinase 1 OS=Dictyostelium discoideum ... [more]
GCP1_ARATH3.968e-4149.43Germination-specific cysteine protease 1 OS=Arabid... [more]
XCP1_ARATH9.774e-4046.74Xylem cysteine proteinase 1 OS=Arabidopsis thalian... [more]
ORYA_ORYSJ9.774e-4041.63Oryzain alpha chain OS=Oryza sativa subsp. japonic... [more]
CYSP2_DICDI1.667e-3946.70Cysteine proteinase 2 OS=Dictyostelium discoideum ... [more]
ALEU_ARATH1.667e-3944.54Thiol protease aleurain OS=Arabidopsis thaliana GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01B22_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01B22, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835363 ID=CF835363|Name=CF835363|organism=Citrus sinensis|type=EST|length=753bp
CCGTTAAAACAGTGGTTCTCTTTCTGGTCTCTCTCGTCGTCTTCTCCGCT
GTTTCATCAGGGACGTTGATCGACGATGTTGATCAGATGATCAGGCAAGT
AACGGACGGCGGTGACGAGATCCTAAGCCACCACGAGAGCACCAACAACG
ACCTCTTGGGTGCAGAGCACCACTTCTCCCTATTCAAGAAGAAGTTCAAT
AAAGCGTACGCTTCGCAGGAGGAGCACGACCATAGGTTCACTATTTTCAA
GGCCAACTTGCGACGCGCCGCGCGTCACCAGAAGCTCGACCCGAGCGCCA
CCCACGGCATCACTCAGTTCTCCGACTTGACTCCGGCCGAGTTCCGCCGG
ACGTACCTTGGCCTCAGGAGGAAGCTGAGGCTGCCTAAGGATGCGGATCA
GGCGCCGATCTTGCCTACGAATGATTTGCCGGCGGATTTTGATTGGCGAG
AGAAGGGCGCTGTAGGCCCTGTTAAAGATCAGGGTTCATGCGGATCATGC
TGGAGTTTCAGTACAACAGGGGCCTTGGAAGGTGCTAACTTCCTGGCAAC
TGGAAAGCTTGTGAGCCTTAGCGAGCAACAGCTTGTGGATTGCGATCACG
AGTGTGATCCTGAGGAACCAGGTTCTTGTGATTCTGGATGCAATGGTGGG
CTTATGAACAGTGCTTTTGAGTACACACTCAAGGCTGGTGGGCTTATGCG
GGAGGAAGACTATCCTTACACCGGCACTGATCGTGGCCACGCCTGCAAAT
TTG
back to top