CF835366

Overview
NameCF835366
Unique NameCF835366
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length660
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF835366_ssr130 microsatellite CF835366_ssr130:130..141. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig6347 contig Csv1_Contig6347:30..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835366 vs. ExPASy Swiss-Prot
Match: ARFH_ARATH (Auxin response factor 8 OS=Arabidopsis thaliana GN=ARF8 PE=2 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 3.001e-44
Identity = 83/105 (79.05%), Postives = 93/105 (88.57%), Query Frame = -3
Query:  344 HNVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQG 658
            H  GQI+    T+ FVKVYKSGSVGRSLDISRFSSY+ELREELG+MF IEG  EDPLRSGWQLVFVD+END+LLLGDDPWE+FV+NVWYIKILSPEDV +MG+ G
Sbjct:  693 HGAGQINSSNQTKNFVKVYKSGSVGRSLDISRFSSYHELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPEDVHQMGDHG 797          
BLAST of CF835366 vs. ExPASy Swiss-Prot
Match: ARFL_ORYSJ (Auxin response factor 12 OS=Oryza sativa subsp. japonica GN=ARF12 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.647e-42
Identity = 84/104 (80.77%), Postives = 94/104 (90.38%), Query Frame = -3
Query:  344 NVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQG 655
            N G+ D  T  RTFVKVYKSGSVGRSLDI+RFS+Y ELREELGQMFGI+G+ +DP RSGWQLVFVDRENDVLLLGDDPWE+FV++VWYIKILSPEDV KMG+QG
Sbjct:  710 NTGENDPAT--RTFVKVYKSGSVGRSLDITRFSNYAELREELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHKMGKQG 811          
BLAST of CF835366 vs. ExPASy Swiss-Prot
Match: ARFL_ORYSI (Auxin response factor 12 OS=Oryza sativa subsp. indica GN=ARF12 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.647e-42
Identity = 84/104 (80.77%), Postives = 94/104 (90.38%), Query Frame = -3
Query:  344 NVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQG 655
            N G+ D  T  RTFVKVYKSGSVGRSLDI+RFS+Y ELREELGQMFGI+G+ +DP RSGWQLVFVDRENDVLLLGDDPWE+FV++VWYIKILSPEDV KMG+QG
Sbjct:  708 NTGENDPAT--RTFVKVYKSGSVGRSLDITRFSNYAELREELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHKMGKQG 809          
BLAST of CF835366 vs. ExPASy Swiss-Prot
Match: ARFF_ARATH (Auxin response factor 6 OS=Arabidopsis thaliana GN=ARF6 PE=2 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 3.434e-40
Identity = 81/116 (69.83%), Postives = 98/116 (84.48%), Query Frame = -3
Query:  290 TRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVE--SFSPSSG--QRANSRGNC 625
            + TFVKVYKSGS GRSLDIS+FSSY+ELR EL +MFG+EG+ EDP+RSGWQLVFVDRENDVLLLGDDPW  FVS+VW IKILSP++VQ+MG++G+E  + +PSS    +  S GNC
Sbjct:  795 SNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGKRGLELLNSAPSSNNVDKLPSNGNC 910          
BLAST of CF835366 vs. ExPASy Swiss-Prot
Match: ARFF_ORYSJ (Auxin response factor 6 OS=Oryza sativa subsp. japonica GN=ARF6 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 8.458e-39
Identity = 76/112 (67.86%), Postives = 96/112 (85.71%), Query Frame = -3
Query:  293 PTRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRGN 628
            P  TFVKVYKSG+VGR LDI+RFSSY+ELR E+G++FG+EG+ EDPLRSGWQLVFVDRE+DVLL+GDDPW+ FV++V  IKILSP++VQ+MG+ G+E FS S+ +  NS  N
Sbjct:  775 PHATFVKVYKSGTVGRLLDITRFSSYHELRSEVGRLFGLEGQLEDPLRSGWQLVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKPGIELFSTSARRLGNSCDN 886          
BLAST of CF835366 vs. ExPASy Swiss-Prot
Match: ARFF_ORYSI (Auxin response factor 6 OS=Oryza sativa subsp. indica GN=ARF6 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 8.458e-39
Identity = 76/112 (67.86%), Postives = 96/112 (85.71%), Query Frame = -3
Query:  293 PTRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRGN 628
            P  TFVKVYKSG+VGR LDI+RFSSY+ELR E+G++FG+EG+ EDPLRSGWQLVFVDRE+DVLL+GDDPW+ FV++V  IKILSP++VQ+MG+ G+E FS S+ +  NS  N
Sbjct:  775 PHATFVKVYKSGTVGRLLDITRFSSYHELRSEVGRLFGLEGQLEDPLRSGWQLVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKPGIELFSTSARRLGNSCDN 886          
BLAST of CF835366 vs. ExPASy Swiss-Prot
Match: ARFQ_ORYSJ (Auxin response factor 17 OS=Oryza sativa subsp. japonica GN=ARF17 PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.143e-35
Identity = 73/109 (66.97%), Postives = 92/109 (84.40%), Query Frame = -3
Query:  302 PTRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANS 628
            P  TFVKVYKSG+ GRSLDI+RFSSY+ELR ELG++FG+EG+ E+PLRSGWQLVFVDRE+DVLL+GDDPW+ FV++V  IKILSP++VQ+MG+   E  S + G+R  S
Sbjct:  784 PPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLENPLRSGWQLVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKP-FELLSSAPGKRLGS 891          
BLAST of CF835366 vs. ExPASy Swiss-Prot
Match: ARFQ_ORYSI (Auxin response factor 17 OS=Oryza sativa subsp. indica GN=ARF17 PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.143e-35
Identity = 73/109 (66.97%), Postives = 92/109 (84.40%), Query Frame = -3
Query:  302 PTRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANS 628
            P  TFVKVYKSG+ GRSLDI+RFSSY+ELR ELG++FG+EG+ E+PLRSGWQLVFVDRE+DVLL+GDDPW+ FV++V  IKILSP++VQ+MG+   E  S + G+R  S
Sbjct:  784 PPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLENPLRSGWQLVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKP-FELLSSAPGKRLGS 891          
BLAST of CF835366 vs. ExPASy Swiss-Prot
Match: ARFY_ORYSJ (Auxin response factor 25 OS=Oryza sativa subsp. japonica GN=ARF25 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.547e-35
Identity = 71/110 (64.55%), Postives = 88/110 (80.00%), Query Frame = -3
Query:  290 TFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRGNC 619
            TFVKVYKSGS+GRSLDISRFSSY ELR EL ++FG+EG+ EDP+RSGWQLVFVDREND+LL+GDDPW+ F ++VW IKILSP++VQ++  +G +    S G R      C
Sbjct:  767 TFVKVYKSGSLGRSLDISRFSSYCELRSELERLFGLEGQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFANSVWCIKILSPQEVQQL-VRGGDGLLSSPGARMQQSNAC 875          
BLAST of CF835366 vs. ExPASy Swiss-Prot
Match: ARFS_ARATH (Auxin response factor 19 OS=Arabidopsis thaliana GN=ARF19 PE=1 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 2.309e-28
Identity = 60/109 (55.05%), Postives = 80/109 (73.39%), Query Frame = -3
Query:  314 DQLTPTRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQ 640
            +Q    RT+ KV K GSVGRS+D++R+S Y+ELR +L +MFGIEG+ EDPL S W+LV+ D END+LL+GDDPWE FV+ V  IKILS  +VQ+M   G  +  P++ Q
Sbjct:  952 NQTQRMRTYTKVQKRGSVGRSIDVTRYSGYDELRHDLARMFGIEGQLEDPLTSDWKLVYTDHENDILLVGDDPWEEFVNCVQNIKILSSVEVQQMSLDGDLAAIPTTNQ 1060          
The following BLAST results are available for this feature:
BLAST of CF835366 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
ARFH_ARATH3.001e-4479.05Auxin response factor 8 OS=Arabidopsis thaliana GN... [more]
ARFL_ORYSJ1.647e-4280.77Auxin response factor 12 OS=Oryza sativa subsp. ja... [more]
ARFL_ORYSI1.647e-4280.77Auxin response factor 12 OS=Oryza sativa subsp. in... [more]
ARFF_ARATH3.434e-4069.83Auxin response factor 6 OS=Arabidopsis thaliana GN... [more]
ARFF_ORYSJ8.458e-3967.86Auxin response factor 6 OS=Oryza sativa subsp. jap... [more]
ARFF_ORYSI8.458e-3967.86Auxin response factor 6 OS=Oryza sativa subsp. ind... [more]
ARFQ_ORYSJ1.143e-3566.97Auxin response factor 17 OS=Oryza sativa subsp. ja... [more]
ARFQ_ORYSI1.143e-3566.97Auxin response factor 17 OS=Oryza sativa subsp. in... [more]
ARFY_ORYSJ2.547e-3564.55Auxin response factor 25 OS=Oryza sativa subsp. ja... [more]
ARFS_ARATH2.309e-2855.05Auxin response factor 19 OS=Arabidopsis thaliana G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01B24_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01B24, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835366 ID=CF835366|Name=CF835366|organism=Citrus sinensis|type=EST|length=660bp
TTTTTTTTTAACGCTATGACAGCACTTTCATATTAAAACAACCAAAACAC
GGCCTAAAGAAATAGGTTCCAATTTGCAACGTAGTTTAGTTATCTAATCG
ACTTCAGTATTATATTTATCGTACACAAGCATCATCATCATTAAACTACT
AGTCTAGTCTGAAACGTGGGTTTCAGTTATCTGGGAACAATAAACCTGGA
GACACAGGGGGGTTGCACACACAGTTCGTGGCATTATGTAATAGAGTTAT
CTAACATCAATATTCAAGCGAACCAACAGGATCACGACCGCAATTGCCAC
GGCTATTTGCCCGTTGACCCGAGCTTGGGCTGAAGGACTCAACCCCTTGC
TCACCCATTTTCTGCACATCCTCCGGTGAAAGTATCTTGATATACCAAAC
ATTACTCACAAATGCCTCCCATGGGTCGTCTCCAAGGAGAAGCACGTCAT
TCTCCCTGTCGACGAATACAAGCTGCCAGCCTGATCTAAGAGGGTCTTCA
AACTTCCCCTCAATTCCAAACATCTGACCCAGCTCTTCCCGCAGCTCATT
ATAGCTGCTGAACCGGGAGATGTCTAGTGAGCGCCCAACCGAACCCGATT
TATAGACCTTGACAAATGTCCGAGTTGGAGTCAGTTGGTCAATTTGCCCT
ACATTGTGCA
back to top