CF835369

Overview
NameCF835369
Unique NameCF835369
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length815
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1102 contig Csv1_Contig1102:1..815. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835369 vs. ExPASy Swiss-Prot
Match: FH1_ORYSJ (Formin-like protein 1 OS=Oryza sativa subsp. japonica GN=FH1 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.543e-33
Identity = 72/114 (63.16%), Postives = 88/114 (77.19%), Query Frame = -2
Query:  476 EVVKLNEEIAMKESSRKFSHSMNEFLKKAXXXXXXXXXXXSVALSMVKEITEYFHGNSAKEEAHPFRIFLVVKEFLSTLDQVCKEVGRINERTIYSSVR--PMPTNPALPPAFP 811
            EV++LNEE+  +E + +F  SM +FLK+A           SVALS+VKEITEYFHG+SAKEEAHPFRIF+VV++FLS LDQVCKEVGRIN+RTI SSVR  P+P NP +P  FP
Sbjct:  825 EVLRLNEEVKSREDAWRFHDSMQKFLKRADDDIIRVQAQESVALSLVKEITEYFHGDSAKEEAHPFRIFMVVRDFLSVLDQVCKEVGRINDRTIASSVRHFPVPVNPMMPQLFP 938          
BLAST of CF835369 vs. ExPASy Swiss-Prot
Match: FH1_ARATH (Formin-like protein 1 OS=Arabidopsis thaliana GN=FH1 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 3.600e-30
Identity = 67/120 (55.83%), Postives = 84/120 (70.00%), Query Frame = -2
Query:  458 EVVKLNEEIAMKESSRKFSHSMNEFLKKAXXXXXXXXXXXSVALSMVKEITEYFHGNSAKEEAHPFRIFLVVKEFLSTLDQVCKEVGRINERTIYSSVR--PMPTNPALPPAFPGFNGRQ 811
            E +++   I  + +S++FS SM  FLK+A           SVALS+VKEITEYFHGNSAKEEAHPFRIFLVV++FL  +D+VCKEVG INERT+ SS    P+P NP +P   PG  GR+
Sbjct:  906 EAIQVQSTITEESNSQRFSESMKTFLKRAEEEIIRVQAQESVALSLVKEITEYFHGNSAKEEAHPFRIFLVVRDFLGVVDRVCKEVGMINERTMVSSAHKFPVPVNPMMPQPLPGLVGRR 1025          
BLAST of CF835369 vs. ExPASy Swiss-Prot
Match: FH15_ORYSJ (Formin-like protein 15 OS=Oryza sativa subsp. japonica GN=FH15 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 5.210e-21
Identity = 49/107 (45.79%), Postives = 71/107 (66.36%), Query Frame = -2
Query:  491 EVVKLNEEIAMKESSRKFSHSMNEFLKKAXXXXXXXXXXXSVALSMVKEITEYFHGNSAKEEAHPFRIFLVVKEFLSTLDQVCKEVGRINERTIYSSVRPMPTNPAL 811
            E ++LN+++   +  ++F  S+ EFL+KA           S+ALS+V+E TE+FHG+S KEE HP RIF+VV++FL+ LD VCK+VGR+NERT   S   +   P L
Sbjct:  664 EALQLNQQLGSDDHCKRFRASIGEFLQKAEAEITAVQAQESLALSLVRETTEFFHGDSVKEEGHPLRIFMVVRDFLTVLDHVCKDVGRMNERTAIGSSLRLENAPVL 770          
BLAST of CF835369 vs. ExPASy Swiss-Prot
Match: FH2_ARATH (Formin-like protein 2 OS=Arabidopsis thaliana GN=FH2 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 6.804e-21
Identity = 54/114 (47.37%), Postives = 70/114 (61.40%), Query Frame = -2
Query:  476 EVVKLNEEIAMKESSRKFSHSMNEFLKKAXXXXXXXXXXXSVALSMVKEITEYFHGNSAKEEAHPFRIFLVVKEFLSTLDQVCKEVGRINERTIYSSVRPM--PTNPALPPAFP 811
            +V ++  E+  +    +F  SMN FL K               + MVKE+TEYFHGNS   E HPFRIF VV++FL+ LDQVCKEVGR+NERT+Y S+ P+  P+N    P FP
Sbjct:  763 KVKEVITELKQETGVERFLESMNSFLNKGEKEITELQSHGDNVMKMVKEVTEYFHGNS---ETHPFRIFAVVRDFLTILDQVCKEVGRVNERTVYGSM-PLHSPSNQTATPLFP 872          
BLAST of CF835369 vs. ExPASy Swiss-Prot
Match: FH8_ORYSJ (Formin-like protein 8 OS=Oryza sativa subsp. japonica GN=FH8 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.569e-17
Identity = 45/80 (56.25%), Postives = 59/80 (73.75%), Query Frame = -2
Query:  530 RKFSHSMNEFLKKAXXXXXXXXXXXSVALSMVKEITEYFHGNSAKEEAHPFRIFLVVKEFLSTLDQVCKEVGRI-NERTI 766
            ++F  SM +FLK+A             AL  VK+ITEYFHG++AKEEAHP RIF+VV++FLSTLDQVC+EVGR+  +RT+
Sbjct:  776 QRFFMSMQDFLKEAEREIERVRGEERRALGRVKDITEYFHGDTAKEEAHPLRIFMVVRDFLSTLDQVCREVGRMQQDRTV 855          
BLAST of CF835369 vs. ExPASy Swiss-Prot
Match: FH6_ARATH (Formin-like protein 6 OS=Arabidopsis thaliana GN=FH6 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 5.961e-17
Identity = 45/92 (48.91%), Postives = 58/92 (63.04%), Query Frame = -2
Query:  539 MEVVKLNEEIAMKESSRKFSHSMNEFLKKAXXXXXXXXXXXSVALSMVKEITEYFHGNSAKEEAHPFRIFLVVKEFLSTLDQVCKEVGRINE 814
            M + KL   +  + +  +F  SM  FLK+A             ALSMVKE+TEYFHGN+A+EEAHP RIF+VV++FL  LD VCKEV  + E
Sbjct:  762 MGLDKLRSFLKTETTQGRFFDSMKTFLKEAEEEIRKIKGGERKALSMVKEVTEYFHGNAAREEAHPLRIFMVVRDFLGVLDNVCKEVKTMQE 853          
BLAST of CF835369 vs. ExPASy Swiss-Prot
Match: FH13_ORYSJ (Formin-like protein 13 OS=Oryza sativa subsp. japonica GN=FH13 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.734e-16
Identity = 47/110 (42.73%), Postives = 66/110 (60.00%), Query Frame = -2
Query:  485 VVKLNEEIAMKESSRKFSHSMNEFLKKAXXXXXXXXXXXSVALSMVKEITEYFHGNSAKEEAHPFRIFLVVKEFLSTLDQVCKEVGRINERTIYSSVRP--MPTNPALPP 808
            V++L E  + + +S  F  +M  FL++A             AL +VKE TEYFHG++ KEE HP RIF+VV EFL  LD+VC++VGR  ER +  S +   +P   +LPP
Sbjct:  646 VLQLKETCSDQGASENFFQAMVVFLRRAEAEIKNMKTAEENALRLVKETTEYFHGDATKEEPHPLRIFVVVDEFLLILDRVCRDVGRTPERVMMGSGKSFRVPAGTSLPP 755          
BLAST of CF835369 vs. ExPASy Swiss-Prot
Match: FH4_ORYSJ (Formin-like protein 4 OS=Oryza sativa subsp. japonica GN=FH4 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.046e-16
Identity = 44/82 (53.66%), Postives = 53/82 (64.63%), Query Frame = -2
Query:  515 FSHSMNEFLKKAXXXXXXXXXXXSVALSMVKEITEYFHGNSAKEEAHPFRIFLVVKEFLSTLDQVCKEVGRINERTIYSSVR 760
            F  +M EFLK+A             AL  VKEITEYFHGN+ KEEAHP RIF+VV++FLS LD VC+EV +  +RT   S R
Sbjct:  736 FFATMREFLKEAEQEIEQVRHDEKAALGRVKEITEYFHGNAVKEEAHPLRIFMVVRDFLSMLDHVCREVSQ-QDRTFVGSAR 816          
BLAST of CF835369 vs. ExPASy Swiss-Prot
Match: FH14_ORYSJ (Formin-like protein 14 OS=Oryza sativa subsp. japonica GN=FH14 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 6.820e-13
Identity = 37/88 (42.05%), Postives = 58/88 (65.91%), Query Frame = -2
Query:  551 EVVKLNEEIAMKESSRKFSHSMNEFLKKAXXXXXXXXXXXSVALSMVKEITEYFHGN-SAKEEAHPFRIFLVVKEFLSTLDQVCKEVG 811
            +V++LN  +   +S+R+F ++M+ FL++A           S+ LS VKE+TEYFHG  S+ +E H  R+F  V+EFL+ LD++CKE G
Sbjct:  718 DVLRLNSMVTSADSARRFHNTMSMFLRQAEEEILKLQAQESICLSCVKEVTEYFHGELSSGDEGHMARVFGSVREFLAMLDRICKEAG 805          
The following BLAST results are available for this feature:
BLAST of CF835369 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
FH1_ORYSJ4.543e-3363.16Formin-like protein 1 OS=Oryza sativa subsp. japon... [more]
FH1_ARATH3.600e-3055.83Formin-like protein 1 OS=Arabidopsis thaliana GN=F... [more]
FH15_ORYSJ5.210e-2145.79Formin-like protein 15 OS=Oryza sativa subsp. japo... [more]
FH2_ARATH6.804e-2147.37Formin-like protein 2 OS=Arabidopsis thaliana GN=F... [more]
FH8_ORYSJ1.569e-1756.25Formin-like protein 8 OS=Oryza sativa subsp. japon... [more]
FH6_ARATH5.961e-1748.91Formin-like protein 6 OS=Arabidopsis thaliana GN=F... [more]
FH13_ORYSJ1.734e-1642.73Formin-like protein 13 OS=Oryza sativa subsp. japo... [more]
FH4_ORYSJ5.046e-1653.66Formin-like protein 4 OS=Oryza sativa subsp. japon... [more]
FH14_ORYSJ6.820e-1342.05Formin-like protein 14 OS=Oryza sativa subsp. japo... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C02_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835369 ID=CF835369|Name=CF835369|organism=Citrus sinensis|type=EST|length=815bp
TTTTTTTTTTTTTACTTGACAGAATAATCTTTGAATTTTAAGCTCTTTGA
CAGATAATTTCGAAAAGGTTTTTAACAGATATACCAAATCTACTGTTTCA
GCAAATACTAATTACTTGTTGACACTATTCCCTCCGTTCCGCCTATGTTA
CACAAAAGATAAATAGTTTCTAAAAATCTTAATGTGAATATTATACAGAA
AATGCAGCAGCCAAATGAAGATTATGAACTCTACTGCAAGCTCTATCCAA
AATACACTCAGCATCCACCACTTCTGATCTGCGTCCTTGTGATTTTTAGC
AGAGAAATACAGAGAATCGCCTGAGATGAAAATAAGGCATTCAGATTGGG
ATAAGCTTGTCCTTGTGATTTTTAGCAGAGAAATACAGAGAATCGCCTGA
GATGAAAATAAGGCATTAAGATTGGGATAAGCTTTCATCATCTGACGAAC
TATAATGCTGCCGTCCATTAAAGCCAGGGAAAGCTGGCGGAAGGGCTGGG
TTTGTTGGCATTGGACGCACTGAACTGTATATAGTTCTCTCATTGATTCT
GCCAACTTCCTTGCATACCTGATCAAGAGTAGAAAGAAATTCCTTTACCA
CCAAGAAAATCCGGAATGGATGAGCTTCTTCCTTAGCTGAGTTCCCATGG
AAGTACTCAGTTATTTCCTTCACCATAGAAAGAGCAACACTCTCTTGGGA
TTGGATGCTTATAATCTCTTGTTCTGCCTTTTTCAAGAACTCGTTCATTG
AATGGGAGAATTTCCGACTGCTTTCCTTCATTGCAATTTCTTCGTTTAAT
TTCACTACTTCCATT
back to top