CF835371

Overview
NameCF835371
Unique NameCF835371
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length771
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5402 contig Csv1_Contig5402:223..993. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835371 vs. ExPASy Swiss-Prot
Match: GSTF1_ARATH (Glutathione S-transferase 1 OS=Arabidopsis thaliana GN=GST1 PE=1 SV=2)

HSP 1 Score: 202.216 bits (513), Expect = 2.589e-51
Identity = 103/157 (65.61%), Postives = 117/157 (74.52%), Query Frame = -2
Query:  300 FGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPGKPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLFQSKYLAWDSFPLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 770
            FG+VP  E GD K+FESRAITQYIA EF DKG  L   GK +A + +  E+E+ +FDP  SKL WE V KP++GMTTD   VEE EAKLAK+LDVYE RL +SKYLA D F LVDLH +P I  LLGTP KKLFD RPHVSAW ADITSRP+  KVL
Sbjct:   52 FGKVPAFEDGDFKIFESRAITQYIAHEFSDKGNNLLSTGKDMAIIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVDLHTIPVIQYLLGTPTKKLFDERPHVSAWVADITSRPSAQKVL 208          
BLAST of CF835371 vs. ExPASy Swiss-Prot
Match: GSTF_HYOMU (Glutathione S-transferase OS=Hyoscyamus muticus PE=1 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 3.381e-51
Identity = 101/158 (63.92%), Postives = 117/158 (74.05%), Query Frame = -2
Query:  300 FGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPG-KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLFQSKYLAWDSFPLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 770
            FGQVP  E GD KLFESRAITQYIA  + DKG QL     K +A + VW EVE+ +FDP +SKL +E+V KPM GM TD AAV ENE KL K+LDVYE+RL  SKYL  DSF L DLHH P +N L+GT VK LFD+RPHVSAW ADI +RPAW+K +
Sbjct:   51 FGQVPAFEDGDLKLFESRAITQYIAHTYADKGNQLLANDPKKMAIMSVWMEVESQKFDPVASKLTFEIVIKPMLGMVTDDAAVAENEEKLGKVLDVYESRLKDSKYLGGDSFTLADLHHAPAMNYLMGTKVKSLFDSRPHVSAWCADILARPAWSKAI 208          
BLAST of CF835371 vs. ExPASy Swiss-Prot
Match: GST11_ARATH (Glutathione S-transferase 11 OS=Arabidopsis thaliana GN=GST11 PE=1 SV=3)

HSP 1 Score: 197.593 bits (501), Expect = 6.377e-50
Identity = 104/158 (65.82%), Postives = 117/158 (74.05%), Query Frame = -2
Query:  300 FGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPG-KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLFQSKYLAWDSFPLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 770
            FG+VP  E GD KLFESRAITQYIA  + DKG QL   G K IA + +  E+E+ +FDP  SKL WE V KP++GMTTD   VEE EAKLAK+LDVYE RL +SKYLA D F LVDLH +P I  LLGTP KKLFD RPHVSAW ADITSRP+  KVL
Sbjct:   52 FGKVPAFEDGDFKLFESRAITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDKFTLVDLHTIPVIQYLLGTPTKKLFDERPHVSAWVADITSRPSAKKVL 209          
BLAST of CF835371 vs. ExPASy Swiss-Prot
Match: GSTF1_TOBAC (Glutathione S-transferase PARB OS=Nicotiana tabacum GN=PARB PE=2 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 4.133e-49
Identity = 96/162 (59.26%), Postives = 120/162 (74.07%), Query Frame = -2
Query:  288 FGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPG-KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLFQSKYLAWDSFPLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVLALLK 770
            FGQVP  E GD KLFESRAITQYIA  + D G QL     K +  + VW EVE  +F+PP++KL WEL  KP+ GMTTD AAV+E+EA+L+K+LD+YE +L +SKYL  DSF LVDLHH+PNI  L+ + VK++FD+RP VSAW ADI +RPAW K L  L+
Sbjct:   51 FGQVPAFEDGDLKLFESRAITQYIAHVYADNGYQLILQDPKKMPSMSVWMEVEGQKFEPPATKLTWELGIKPIIGMTTDDAAVKESEAQLSKVLDIYETQLAESKYLGGDSFTLVDLHHIPNIYYLMSSKVKEVFDSRPRVSAWCADILARPAWVKGLEKLQ 212          
BLAST of CF835371 vs. ExPASy Swiss-Prot
Match: GSTF2_TOBAC (Glutathione S-transferase APIC OS=Nicotiana tabacum GN=APIC PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 2.051e-48
Identity = 96/162 (59.26%), Postives = 117/162 (72.22%), Query Frame = -2
Query:  288 FGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPGKPIAPLL-VWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLFQSKYLAWDSFPLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVLALLK 770
            FGQVP  E GD KLFESRAITQYIA  + D G QL        P++ VW EVE  +F+P +SKL WEL  KP+ GMTTD  AV+E+E +L+K+LD+YE RL +SKYL  DSF LVDLHH+PNI  L+ T VK++FD+RP VSAW ADI +RPAW K L  L+
Sbjct:   51 FGQVPAFEDGDLKLFESRAITQYIAHVYADNGYQLILQDPKKMPIMSVWMEVEGQKFEPHASKLTWELGIKPIIGMTTDDDAVKESEVQLSKVLDIYETRLAESKYLGGDSFTLVDLHHIPNIYYLMSTKVKEVFDSRPRVSAWCADILARPAWVKGLEKLQ 212          
BLAST of CF835371 vs. ExPASy Swiss-Prot
Match: GSTF_SILCU (Glutathione S-transferase OS=Silene cucubalus GN=GST PE=1 SV=3)

HSP 1 Score: 191.815 bits (486), Expect = 3.499e-48
Identity = 104/165 (63.03%), Postives = 123/165 (74.55%), Query Frame = -2
Query:  288 FGQVPVLEHGDQKLFESRAITQYIA--QEFPDKGTQLTCPGK-PIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLFQSKYL-AWDSFPLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVLALLK 770
            FGQVP LE G+ KLFESRAIT+Y+A   +  ++GT L    K  +A  LVW+EVEA QFDP +SKL WELV+K +FGM TD   VEENEAKLAK+LDVYEARL +S+YL A DSF LVDLHHLP +  L+GT VKKLF+ R HVSAW   I +RP+W K LAL K
Sbjct:   51 FGQVPALEDGEIKLFESRAITKYLAYTHDHQNEGTSLIHKEKHEMAAQLVWEEVEAHQFDPVASKLAWELVFKGIFGMQTDTTVVEENEAKLAKVLDVYEARLTESEYLGANDSFTLVDLHHLPLLGYLMGTQVKKLFEERAHVSAWCKKILARPSWEKTLALQK 215          
BLAST of CF835371 vs. ExPASy Swiss-Prot
Match: GSTF6_ARATH (Glutathione S-transferase 6, chloroplastic OS=Arabidopsis thaliana GN=GST6 PE=1 SV=3)

HSP 1 Score: 191.045 bits (484), Expect = 5.969e-48
Identity = 100/163 (61.35%), Postives = 120/163 (73.62%), Query Frame = -2
Query:  288 FGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPG--KPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLFQSKYLAWDSFPLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVLALLK 770
            FGQ+P LE GD  LFESRAITQY+A+E+ +KG +L      K  A   VW +VE  QFDP +SKL +E V+K MFGMTTDPAAV+E E KL K+LDVYEARL +S++LA DSF L DLHHLP I+ LLGT  K LFD+RP VS W   I++RPAWAKV+ L K
Sbjct:  100 FGQIPALEDGDLTLFESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVFKGMFGMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVLFDSRPKVSEWIKKISARPAWAKVIDLQK 262          
BLAST of CF835371 vs. ExPASy Swiss-Prot
Match: GST16_ARATH (Glutathione S-transferase 16 OS=Arabidopsis thaliana GN=GST16 PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.521e-43
Identity = 95/161 (59.01%), Postives = 111/161 (68.94%), Query Frame = -2
Query:  300 FGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLT-CPGKPIAPLLVWK---EVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLFQSKYLAWDSFPLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKVL 770
            FGQVP  E GD KLFESRAITQYIA  + ++GT L     K IA   +     +VEA QFDP +SKL WE V+K  +G+ TD A V E EAKLAK+LDVYEARL + KYLA ++F L DLHH+P I  LLGTP KKLF  RP V+ W A+IT RPA  KVL
Sbjct:   52 FGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLPADSKNIAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGLNTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVL 212          
BLAST of CF835371 vs. ExPASy Swiss-Prot
Match: GSTF4_ARATH (Glutathione S-transferase PM24 OS=Arabidopsis thaliana GN=PM24.1 PE=1 SV=3)

HSP 1 Score: 172.17 bits (435), Expect = 2.869e-42
Identity = 92/160 (57.50%), Postives = 112/160 (70.00%), Query Frame = -2
Query:  303 FGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLT-CPGKPI---APLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLFQSKYLAWDSFPLVDLHHLPNINLLLGTPVKKLFDARPHVSAWAADITSRPAWAKV 770
            FGQVP  E GD KLFESRAITQYIA  + ++GT L     K I   A + +  +VE  QFDP +SKL +E ++K ++G+TTD A V E EAKLAK+LDVYEARL + KYLA ++F L DLHH+P I  LLGTP KKLF  RP V+ W A+IT RPA  KV
Sbjct:   52 FGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKV 211          
BLAST of CF835371 vs. ExPASy Swiss-Prot
Match: GSTF3_MAIZE (Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE=1 SV=4)

HSP 1 Score: 129.798 bits (325), Expect = 1.633e-29
Identity = 75/170 (44.12%), Postives = 100/170 (58.82%), Query Frame = -2
Query:  264 FGQVPVLEHGDQKLFESRAITQYIAQEFPDKGTQLTCPGKPIAPLLVWKEVEALQFDPPSSKLNWELVYKPMFGMTTDPAAVEENEAKLAKILDVYEARLFQSKYLAWDSFPLVDLHHLPNINLLLGTPVKK-LFDARPHVSAWAADITSRPAWAKVLALLKH*TLCPLP 770
            FGQ+P L  GD+ LFESRAI +YIA ++  +GT L       A L VW EVE+  F P +S L ++L+ +P+ G   D A VE++  +LAK+LDVYEA L ++KYLA D F L D +H     L    P +     ARPHV AW   I +RPA+ K +A +      PLP
Sbjct:   52 FGQIPALVDGDEVLFESRAINRYIASKYASEGTDLLPATASAAKLEVWLEVESHHFHPNASPLVFQLLVRPLLGGAPDAAVVEKHAEQLAKVLDVYEAHLARNKYLAGDEFTLADANHALLPALTSARPPRPGCVAARPHVKAWWEAIAARPAFQKTVAAI------PLP 215          
The following BLAST results are available for this feature:
BLAST of CF835371 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
GSTF1_ARATH2.589e-5165.61Glutathione S-transferase 1 OS=Arabidopsis thalian... [more]
GSTF_HYOMU3.381e-5163.92Glutathione S-transferase OS=Hyoscyamus muticus PE... [more]
GST11_ARATH6.377e-5065.82Glutathione S-transferase 11 OS=Arabidopsis thalia... [more]
GSTF1_TOBAC4.133e-4959.26Glutathione S-transferase PARB OS=Nicotiana tabacu... [more]
GSTF2_TOBAC2.051e-4859.26Glutathione S-transferase APIC OS=Nicotiana tabacu... [more]
GSTF_SILCU3.499e-4863.03Glutathione S-transferase OS=Silene cucubalus GN=G... [more]
GSTF6_ARATH5.969e-4861.35Glutathione S-transferase 6, chloroplastic OS=Arab... [more]
GST16_ARATH1.521e-4359.01Glutathione S-transferase 16 OS=Arabidopsis thalia... [more]
GSTF4_ARATH2.869e-4257.50Glutathione S-transferase PM24 OS=Arabidopsis thal... [more]
GSTF3_MAIZE1.633e-2944.12Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C03_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835371 ID=CF835371|Name=CF835371|organism=Citrus sinensis|type=EST|length=771bp
TTTTTTTTTTTTTTTTTACGCAAAATACCCCCAGCTTCGTTTTATTAGGG
GACATAGATAAAATAAAAACCTCAAGCCATCAACATCAAAGTTGAATATG
AGGCAGTGCTGTTGAAATACAAAAGCGGTAGTACAAACTACAAAGCATCA
ATATTCTGCAAAATATTGATGACAAACGCCAAACAAGAAAATACGAACTC
CAAAACCAGCCTAATAGGTATTACAAAAGATAAGTGACCACCGAGGAGCG
ACTAACGTCTAGTAGGTAGCGGGCAAAGTGTTCAGTGTTTGAGCAAGGCA
AGGACCTTAGCCCAAGCCGGTCTGGAAGTGATATCAGCTGCCCATGCGCT
AACATGGGGGCGTGCATCAAACAGCTTCTTGACAGGCGTCCCCAACAACA
AATTAATATTGGGGAGATGATGCAAATCGACCAAGGGGAAGCTGTCCCAC
GCCAAGTATTTGGACTGAAACAAACGGGCCTCGTAAACATCTAAAATTTT
GGCAAGCTTAGCTTCATTTTCTTCAACCGCAGCTGGATCAGTGGTCATTC
CAAACATTGGCTTGTACACGAGCTCCCAGTTGAGCTTCGATGATGGGGGG
TCGAACTGGAGTGCCTCCACCTCCTTCCATACCAATAACGGGGCGATGGG
CTTGCCTGGGCATGTTAACTGGGTGCCTTTGTCTGGAAACTCCTGGGCGA
TGTATTGGGTGATTGCCCTTGATTCAAAGAGCTTCTGGTCGCCGTGTTCA
AGCACCGGAACTTGACCGAAT
back to top